• Gene id: 54910

Gene Summary

• Gene Symbol: SEMA4C   Gene   UCSC   Ensembl
• Aliases: M-SEMA-F, SEMACL1, SEMAF, SEMAI
• Gene name: semaphorin 4C
• Alternate names: semaphorin-4C, M-Sema F, sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4C,
• Gene location: 2q11.2 (71255196: 71239623)     Exons: 26     NC_000023.11
• OMIM: 604462

Protein Summary

• Protein general information: Q9C0C4  
  • Name: Semaphorin 4C
  • Length: 833  
  • Mass: 92623
• Sequence:

  MAPHWAVWLLAARLWGLGIGAEVWWNLVPRKTVSSGELATVVRRFSQTGIQDFLTLTLTEPTGLLYVGAREALFA
  FSMEALELQGAISWEAPVEKKTECIQKGKNNQTECFNFIRFLQPYNASHLYVCGTYAFQPKCTYVNMLTFTLEHG
  EFEDGKGKCPYDPAKGHAGLLVDGELYSATLNNFLGTEPIILRNMGPHHSMKTEYLAFWLNEPHFVGSAYVPESV
  GSFTGDDDKVYFFFRERAVESDCYAEQVVARVARVCKGDMGGARTLQRKWTTFLKARLACSAPNWQLYFNQLQAM
  HTLQDTSWHNTTFFGVFQAQWGDMYLSAICEYQLEEIQRVFEGPYKEYHEEAQKWDRYTDPVPSPRPGSCINNWH
  RRHGYTSSLELPDNILNFVKKHPLMEEQVGPRWSRPLLVKKGTNFTHLVADRVTGLDGATYTVLFIGTGDGWLLK
  AVSLGPWVHLIEELQLFDQEPMRSLVLSQSKKLLFAGSRSQLVQLPVADCMKYRSCADCVLARDPYCAWSVNTSR
  CVAVGGHSGSLLIQHVMTSDTSGICNLRGSKKVRPTPKNITVVAGTDLVLPCHLSSNLAHARWTFGGRDLPAEQP
  GSFLYDARLQALVVMAAQPRHAGAYHCFSEEQGARLAAEGYLVAVVAGPSVTLEARAPLENLGLVWLAVVALGAV
  CLVLLLLVLSLRRRLREELEKGAKATERTLVYPLELPKEPTSPPFRPCPEPDEKLWDPVGYYYSDGSLKIVPGHA
  RCQPGGGPPSPPPGIPGQPLPSPTRLHLGGGRNSNANGYVRLQLGGEDRGGLGHPLPELADELRRKLQQRQPLPD
  SNPEESSV

• Structural information:
  • Protein Domains: (30..49-)
    (/note="Sema-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00352-)
    (499..55-)
    (/note="PSI-)
    (556..64-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR002165   IPR016201  IPR001627  IPR036352  IPR027231  IPR015943  
  • Prosite: PS50835 PS51004
  • PDB: 6N5Z
  • PDBsum: 6N5Z
  • STRING: ENSP00000306844
• Other Databases: GeneCards:  SEMA4C  Malacards:  SEMA4C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071526	semaphorin-plexin signaling pathway	IBA	biological process
GO:0050919	negative chemotaxis	IBA	biological process
GO:0048843	negative regulation of axon extension involved in axon guidance	IBA	biological process
GO:0042692	muscle cell differentiation	IBA	biological process
GO:0007411	axon guidance	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0001755	neural crest cell migration	IBA	biological process
GO:0045499	chemorepellent activity	IBA	molecular function
GO:0030335	positive regulation of cell migration	IBA	biological process
GO:0030215	semaphorin receptor binding	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0032874	positive regulation of stress-activated MAPK cascade	IDA	biological process
GO:0042692	muscle cell differentiation	IDA	biological process
GO:0021535	cell migration in hindbrain	ISS	biological process
GO:0071526	semaphorin-plexin signaling pathway	ISS	biological process
GO:0030672	synaptic vesicle membrane	ISS	cellular component
GO:0014069	postsynaptic density	ISS	cellular component
GO:0001843	neural tube closure	ISS	biological process
GO:0030215	semaphorin receptor binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001843	neural tube closure	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0042692	muscle cell differentiation	IEA	biological process
GO:0071526	semaphorin-plexin signaling pathway	IEA	biological process
GO:0021535	cell migration in hindbrain	IEA	biological process
GO:0021549	cerebellum development	IEA	biological process
GO:0098839	postsynaptic density membrane	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0005615	extracellular space	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq