• Gene id: 54879

Gene Summary

• Gene Symbol: ST7L   Gene   UCSC   Ensembl
• Aliases: FAM4B, ST7R, STLR
• Gene name: suppression of tumorigenicity 7 like
• Alternate names: suppressor of tumorigenicity 7 protein-like, ST7-related protein, tumor suppressor ST7 like,
• Gene location: 1p13.2 (112619880: 112517443)     Exons: 22     NC_000001.11
• Gene summary(Entrez): This gene was identified by its similarity to the ST7 tumor suppressor gene found in the chromosome 7q31 region. This gene is clustered in a tail-to-tail manner with the WNT2B gene in a chromosomal region known to be deleted and rearranged in a variety of
• OMIM: 617640

Protein Summary

• Protein general information: Q8TDW4  
  • Name: Suppressor of tumorigenicity 7 protein like (ST7 related protein)
  • Length: 575  
  • Mass: 64779
• Sequence:

  MADRGGVGEAAAVGASPASVPGLNPTLGWRERLRAGLAGTGASLWFVAGLGLLYALRIPLRLCENLAAVTVFLNS
  LTPKFYVALTGTSSLISGLIFIFEWWYFHKHGTSFIEQVSVSHLQPLMGGTESSISEPGSPSRNRENETSRQNLS
  ECKVWRNPLNLFRGAEYRRYTWVTGKEPLTYYDMNLSAQDHQTFFTCDTDFLRPSDTVMQKAWRERNPPARIKAA
  YQALELNNDCATAYVLLAEEEATTIVDAERLFKQALKAGETIYRQSQQCQHQSPQHEAQLRRDTNVLVYIKRRLA
  MCARKLGRIREAVKIMRDLMKEFPPLTMLNIHENLLESLLELQAYPDVQAVLAKYDDISLPKSAAICYTAALLKT
  RTVSEKFSPETASRRGLSTAEINAVEAIHRAVEFNPHVPKYLLEMKSLILPPEHILKRGDSEAIAYAFFHLQHWK
  RIEGALNLLQCTWEGTFRMIPYPLEKGHLFYPYPSCTETADRELLPTFHHVSVYPKKELPLFIHFTAGFCSSTAM
  IAILTHQFPEIMGIFAKAVLGLWCPQPWASSGFEENTQDLKSEDLGLSSG

• Structural information:
  • Interpro: IPR007311  IPR011990  
  • CDD: cd11557
  • STRING: ENSP00000350734
• Other Databases: GeneCards:  ST7L  Malacards:  ST7L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030308	negative regulation of cell growth	IEA	biological process
GO:0030308	negative regulation of cell growth	ISS	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq