Search Result
| Gene id | 54860 | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | MS4A12 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||
| Aliases | Ms4a10 | ||||||||||||||||||||||||||||||||||||||||
| Gene name | membrane spanning 4-domains A12 | ||||||||||||||||||||||||||||||||||||||||
| Alternate names | membrane-spanning 4-domains subfamily A member 12, | ||||||||||||||||||||||||||||||||||||||||
| Gene location |
11q12.2 (60492742: 60507429) Exons: 8 NC_000011.10 |
||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene is a cell surface protein found primarily in the apical membrane of colonocytes. Silencing of this gene in colon cancer cells inhibits the proliferation, cell motility, and chemotactic invasion of cells. This gene is part |
||||||||||||||||||||||||||||||||||||||||
| OMIM | 606550 | ||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q9NXJ0 Name: Membrane spanning 4 domains subfamily A member 12 Length: 267 Mass: 28069 | ||||||||||||||||||||||||||||||||||||||||
| Sequence |
MMSSKPTSHAEVNETIPNPYPPSSFMAPGFQQPLGSINLENQAQGAQRAQPYGITSPGIFASSQPGQGNIQMINP SVGTAVMNFKEEAKALGVIQIMVGLMHIGFGIVLCLISFSFREVLGFASTAVIGGYPFWGGLSFIISGSLSVSAS KELSRCLVKGSLGMNIVSSILAFIGVILLLVDMCINGVAGQDYWAVLSGKGISATLMIFSLLEFFVACATAHFAN QANTTTNMSVLVIPNMYESNPVTPASSSAPPRCNNYSANAPK | ||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: MS4A12  Malacards: MS4A12 | ||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||