• Gene id: 54857

Gene Summary

• Gene Symbol: GDPD2   Gene   UCSC   Ensembl
• Aliases: GDE3, OBDPF
• Gene name: glycerophosphodiester phosphodiesterase domain containing 2
• Alternate names: glycerophosphoinositol inositolphosphodiesterase GDPD2, glycerophosphodiester phosphodiesterase 3, glycerophosphodiester phosphodiesterase domain-containing protein 2, osteoblast differentiation promoting factor,
• Gene location: Xq13.1 (70423030: 70433390)     Exons: 17     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the glycerophosphodiester phosphodiesterase enzyme family. The encoded protein hydrolyzes glycerophosphoinositol to produce inositol 1-phosphate and glycerol. This protein may have a role in osteoblast differentiation and gro
• OMIM: 300940

Protein Summary

• Protein general information: Q9HCC8  
  • Name: Glycerophosphoinositol inositolphosphodiesterase GDPD2 (EC 3.1.4.43) (Glycerophosphodiester phosphodiesterase 3) (Glycerophosphodiester phosphodiesterase domain containing protein 2) (Osteoblast differentiation promoting factor)
  • Length: 539  
  • Mass: 61729
• Sequence:

  MAESPGCCSVWARCLHCLYSCHWRKCPRERMQTSKCDCIWFGLLFLTFLLSLSWLYIGLVLLNDLHNFNEFLFRR
  WGHWMDWSLAFLLVISLLVTYASLLLVLALLLRLCRQPLHLHSLHKVLLLLIMLLVAAGLVGLDIQWQQEWHSLR
  VSLQATAPFLHIGAAAGIALLAWPVADTFYRIHRRGPKILLLLLFFGVVLVIYLAPLCISSPCIMEPRDLPPKPG
  LVGHRGAPMLAPENTLMSLRKTAECGATVFETDVMVSSDGVPFLMHDEHLSRTTNVASVFPTRITAHSSDFSWTE
  LKRLNAGSWFLERRPFWGAKPLAGPDQKEAESQTVPALEELLEEAAALNLSIMFDLRRPPQNHTYYDTFVIQTLE
  TVLNARVPQAMVFWLPDEDRANVQRRAPGMRQIYGRQGGNRTERPQFLNLPYQDLPLLDIKALHKDNVSVNLFVV
  NKPWLFSLLWCAGVDSVTTNDCQLLQQMRYPIWLITPQTYLIIWVITNCVSTMLLLWTFLLQRRFVKKRGKTGLE
  TAVLLTRINNFMME

• Structural information:
  • Protein Domains: (224..47-)
    (/note="GP-PDE"-)
  • Interpro: IPR030395  IPR017946  
  • Prosite: PS51704
  • STRING: ENSP00000414019
• Other Databases: GeneCards:  GDPD2  Malacards:  GDPD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006629	lipid metabolic process	IEA	biological process
GO:0008081	phosphoric diester hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0047394	glycerophosphoinositol inositolphosphodiesterase activity	IEA	molecular function
GO:0030027	lamellipodium	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005884	actin filament	IEA	cellular component
GO:0090527	actin filament reorganization	IEA	biological process
GO:0045669	positive regulation of osteoblast differentiation	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881