• Gene id: 54836

Gene Summary

• Gene Symbol: BSPRY   Gene   UCSC   Ensembl
• Gene name: B-box and SPRY domain containing
• Alternate names: B box and SPRY domain-containing protein, B-box and SPRY-domain containing protein, zetin 1,
• Gene location: 9q32 (99235874: 98457076)     Exons: 18     NC_000010.11

Protein Summary

• Protein general information: Q5W0U4  
  • Name: B box and SPRY domain containing protein
  • Length: 402  
  • Mass: 44381
• Sequence:

  MSAEGAEPGPGSGSGPGPGPLCPEHGQALSWFCGSERRPVCAACAGLGGRCRGHRIRRAEERAEELRNKIVDQCE
  RLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAHQSILTQRVHW
  AEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEIFERTEEAEGILDPQESEMLNFNEKCTRSPLLTQLWATAVLGS
  LSGTEDIRIDERTVSPFLQLSDDRKTLTFSTKKSKACADGPERFDHWPNALAATSFQNGLHAWMVNVQNSCAYKV
  GVASGHLPRKGSGSDCRLGHNAFSWVFSRYDQEFRFSHNGQHEPLGLLRGPAQLGVVLDLQVQELLFYEPASGTV
  LCAHHVSFPGPLFPVFAVADQTISIVR

• Structural information:
  • Protein Domains: (212..40-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR003879  IPR013320  IPR006574  IPR003877   IPR000315  
  • Prosite: PS50188
  • CDD: cd00021
  • STRING: ENSP00000363298
• Other Databases: GeneCards:  BSPRY  Malacards:  BSPRY

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0016567	protein ubiquitination	IBA	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0006816	calcium ion transport	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0031252	cell leading edge	IEA	cellular component
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)