Search Result
| Gene id | 54766 | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | BTG4 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||
| Aliases | APRO3, PC3B | ||||||||||||||||||||||||||||||||||||||||||||
| Gene name | BTG anti-proliferation factor 4 | ||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | protein BTG4, B-cell translocation gene 4, BTG family member 4, protein PC3b, | ||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
11q23.1 (111514733: 111383827) Exons: 20 NC_000011.10 |
||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein can induce G1 arrest in the cell cycle. [provided by RefSeq, Jul 2008] |
||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 605673 | ||||||||||||||||||||||||||||||||||||||||||||
SNPs |
rs4938723 Strand: Allele origin: Allele change: Mutation type: snv NC_000011.10 g.111511840T>C NC_000011.9 g.111382565T>C|SEQ=[T/C]|GENE=BTG4 MIR34B 407041 MIR34C 407042 LOC728196 728196 |
||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q9NY30 Name: Protein BTG4 (BTG family member 4) (Protein PC3b) Length: 223 Mass: 25970 Tissue specificity: Highly expressed in testis and in olfactory epithelium. | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MRDEIATTVFFVTRLVKKHDKLSKQQIEDFAEKLMTILFETYRSHWHSDCPSKGQAFRCIRINNNQNKDPILERA CVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGRWEEWELYQQISYAVSRASSDVSSGTSCDEE SCSKEPRVIPKVSNPKSIYQVENLKQPFQSWLQIPRKKNVVDGRVGLLGNTYHGSQKHPKCYRPAMHRLDRIL | ||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: BTG4  Malacards: BTG4 | ||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
KEGG pathways
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||