• Gene id: 54749

Gene Summary

• Gene Symbol: EPDR1   Gene   UCSC   Ensembl
• Aliases: EPDR, MERP-1, MERP1, UCC1
• Gene name: ependymin related 1
• Alternate names: mammalian ependymin-related protein 1, ependymin related protein 1, mammalian ependymin related protein 1, upregulated in colorectal cancer gene 1 protein,
• Gene location: 7p14.1 (2004534: 1941590)     Exons: 11     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a type II transmembrane protein that is similar to two families of cell adhesion molecules, the protocadherins and ependymins. This protein may play a role in calcium-dependent cell adhesion. This protein is glycosylate

Protein Summary

• Protein general information: Q9UM22  
  • Name: Mammalian ependymin related protein 1 (MERP 1) (Upregulated in colorectal cancer gene 1 protein)
  • Length: 224  
  • Mass: 25437
  • Tissue specificity: Ubiquitous. Detected in brain, heart, skeletal muscle, kidney, testis, ovary and prostate. {ECO
• Sequence:

  MPGRAPLRTVPGALGAWLLGGLWAWTLCGLCSLGAVGAPRPCQAPQQWEGRQVMYQQSSGRNSRALLSYDGLNQR
  VRVLDERKALIPCKRLFEYILLYKDGVMFQIDQATKQCSKMTLTQPWDPLDIPQNSTFEDQYSIGGPQEQITVQE
  WSDRKSARSYETWIGIYTVKDCYPVQETFTINYSVILSTRFFDIQLGIKDPSVFTPPSTCQMAQLEKMSEDCSW

• Structural information:
  • Interpro: IPR001299  IPR018224  
  • Prosite: PS00898 PS00899
  • PDB: 6E7O 6E8N 6JLD
  • PDBsum: 6E7O 6E8N 6JLD
  • STRING: ENSP00000199448
• Other Databases: GeneCards:  EPDR1  Malacards:  EPDR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005764	lysosome	IBA	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007160	cell-matrix adhesion	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0043202	lysosomal lumen	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq