• Gene id: 54733

Gene Summary

• Gene Symbol: SLC35F2   Gene   UCSC   Ensembl
• Aliases: HSNOV1
• Gene name: solute carrier family 35 member F2
• Alternate names: solute carrier family 35 member F2, lung squamous cell cancer related protein LSCC-3,
• Gene location: 11q22.3 (107858786: 107790990)     Exons: 8     NC_000011.10
• OMIM: 611686

Protein Summary

• Protein general information: Q8IXU6  
  • Name: Solute carrier family 35 member F2
  • Length: 374  
  • Mass: 41212
• Sequence:

  MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLSLCICGTAITSQYLAERYKVNTPMLQ
  SFINYCLLFLIYTVMLAFRSGSDNLLVILKRKWWKYILLGLADVEANYVIVRAYQYTTLTSVQLLDCFGIPVLMA
  LSWFILHARYRVIHFIAVAVCLLGVGTMVGADILAGREDNSGSDVLIGDILVLLGASLYAISNVCEEYIVKKLSR
  QEFLGMVGLFGTIISGIQLLIVEYKDIASIHWDWKIALLFVAFALCMFCLYSFMPLVIKVTSATSVNLGILTADL
  YSLFVGLFLFGYKFSGLYILSFTVIMVGFILYCSTPTRTAEPAESSVPPVTSIGIDNLGLKLEENLQETHSAVL

• Structural information:
  • Interpro: IPR009262  
  • STRING: ENSP00000436785
• Other Databases: GeneCards:  SLC35F2  Malacards:  SLC35F2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881