• Gene id: 54726

Gene Summary

• Gene Symbol: OTUD4   Gene   UCSC   Ensembl
• Aliases: DUBA6, HIN1, HSHIN1
• Gene name: OTU deubiquitinase 4
• Alternate names: OTU domain-containing protein 4, HIV-1 induced protein HIN-1,
• Gene location: 4q31.21 (145180588: 145133649)     Exons: 23     NC_000004.12
• Gene summary(Entrez): Alternatively spliced transcript variants have been found for this gene. The smaller protein isoform encoded by the shorter transcript variant is found only in HIV-1 infected cells. [provided by RefSeq, Jul 2010]
• OMIM: 615403

Protein Summary

• Protein general information: Q01804  
  • Name: OTU domain containing protein 4 (EC 3.4.19.12) (HIV 1 induced protein HIN 1)
  • Length: 1114  
  • Mass: 124045
• Sequence:

  MEAAVGVPDGGDQGGAGPREDATPMDAYLRKLGLYRKLVAKDGSCLFRAVAEQVLHSQSRHVEVRMACIHYLREN
  REKFEAFIEGSFEEYLKRLENPQEWVGQVEISALSLMYRKDFIIYREPNVSPSQVTENNFPEKVLLCFSNGNHYD
  IVYPIKYKESSAMCQSLLYELLYEKVFKTDVSKIVMELDTLEVADEDNSEISDSEDDSCKSKTAAAAADVNGFKP
  LSGNEQLKNNGNSTSLPLSRKVLKSLNPAVYRNVEYEIWLKSKQAQQKRDYSIAAGLQYEVGDKCQVRLDHNGKF
  LNADVQGIHSENGPVLVEELGKKHTSKNLKAPPPESWNTVSGKKMKKPSTSGQNFHSDVDYRGPKNPSKPIKAPS
  ALPPRLQHPSGVRQHAFSSHSSGSQSQKFSSEHKNLSRTPSQIIRKPDRERVEDFDHTSRESNYFGLSPEERREK
  QAIEESRLLYEIQNRDEQAFPALSSSSVNQSASQSSNPCVQRKSSHVGDRKGSRRRMDTEERKDKDSIHGHSQLD
  KRPEPSTLENITDDKYATVSSPSKSKKLECPSPAEQKPAEHVSLSNPAPLLVSPEVHLTPAVPSLPATVPAWPSE
  PTTFGPTGVPAPIPVLSVTQTLTTGPDSAVSQAHLTPSPVPVSIQAVNQPLMPLPQTLSLYQDPLYPGFPCNEKG
  DRAIVPPYSLCQTGEDLPKDKNILRFFFNLGVKAYSCPMWAPHSYLYPLHQAYLAACRMYPKVPVPVYPHNPWFQ
  EAPAAQNESDCTCTDAHFPMQTEASVNGQMPQPEIGPPTFSSPLVIPPSQVSESHGQLSYQADLESETPGQLLHA
  DYEESLSGKNMFPQPSFGPNPFLGPVPIAPPFFPHVWYGYPFQGFIENPVMRQNIVLPSDEKGELDLSLENLDLS
  KDCGSVSTVDEFPEARGEHVHSLPEASVSSKPDEGRTEQSSQTRKADTALASIPPVAEGKAHPPTQILNRERETV
  PVELEPKRTIQSLKEKTEKVKDPKTAADVVSPGANSVDSRVQRPKEESSEDENEVSNILRSGRSKQFYNQTYGSR
  KYKSDWGYSGRGGYQHVRSEESWKGQPSRSRDEGYQYHRNVRGRPFRGDRRRSGMGDGHRGQHT

• Structural information:
  • Protein Domains: (34..15-)
    (/note="OTU-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00139,-ECO:0000269|PubMed:29395066")
  • Interpro: IPR003323  IPR038765  
  • Prosite: PS50802
  • STRING: ENSP00000409279
• Other Databases: GeneCards:  OTUD4  Malacards:  OTUD4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IBA	molecular function
GO:1903093	regulation of protein K48-linked deubiquitination	IBA	biological process
GO:2000660	negative regulation of interleukin-1-mediated signaling pathway	IBA	biological process
GO:0034122	negative regulation of toll-like receptor signaling pathway	IBA	biological process
GO:0061578	Lys63-specific deubiquitinase activity	IBA	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0071108	protein K48-linked deubiquitination	IDA	biological process
GO:1903093	regulation of protein K48-linked deubiquitination	IDA	biological process
GO:2000660	negative regulation of interleukin-1-mediated signaling pathway	IDA	biological process
GO:0070536	protein K63-linked deubiquitination	IDA	biological process
GO:1901537	positive regulation of DNA demethylation	IDA	biological process
GO:0060090	molecular adaptor activity	IDA	molecular function
GO:0034122	negative regulation of toll-like receptor signaling pathway	IDA	biological process
GO:0061578	Lys63-specific deubiquitinase activity	IDA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000660	negative regulation of interleukin-1-mediated signaling pathway	IEA	biological process
GO:0070536	protein K63-linked deubiquitination	IEA	biological process
GO:0061578	Lys63-specific deubiquitinase activity	IEA	molecular function
GO:0034122	negative regulation of toll-like receptor signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq