Male Infertility Database

Search Result

Gene id

54657

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

UGT1A4 Gene UCSC Ensembl

Aliases

GNT1, HUG-BR2, UDPGT, UDPGT 1-4, UGT-1A, UGT-1D, UGT1, UGT1-01, UGT1-04, UGT1.1, UGT1.4, UGT1A, UGT1A1, UGT1A4S, UGT1D, hUG-BR1

Gene name

UDP glucuronosyltransferase family 1 member A4

Alternate names

UDP-glucuronosyltransferase 1-4, Bilirubin-specific UDPGT isozyme 1, UDP glucuronosyltransferase 1 family, polypeptide A4, UDP glycosyltransferase 1 family, polypeptide A4, UDP-glucuronosyltransferase 1 family polypeptide A4s, UDP-glucuronosyltransferase 1-1, U,

Gene location

2q37.1 (233718735: 233773299) Exons: 5 NC_000002.12

Gene summary(Entrez)

This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a comp

OMIM

606429

Protein Summary

Protein general information

P22310

Name: UDP glucuronosyltransferase 1 4 (UDPGT 1 4) (UGT1*4) (UGT1 04) (UGT1.4) (EC 2.4.1.17) (Bilirubin specific UDPGT isozyme 2) (hUG BR2) (UDP glucuronosyltransferase 1 D) (UGT 1D) (UGT1D) (UDP glucuronosyltransferase 1A4)

Length: 534 Mass: 60025

Tissue specificity: Isoform 1 and isoform 2 are expressed in liver, kidney, colon and small intestine. Isoform 2 but not isoform 1 is expressed in esophagus. Not expressed in skin. {ECO

Sequence

MARGLQVPLPRLATGLLLLLSVQPWAESGKVLVVPTDGSPWLSMREALRELHARGHQAVVLTPEVNMHIKEEKFF
TLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLKRYSRSMAIMNNVSLALHRCCVELLHNEALIRHLNATSFDVVL
TDPVNLCGAVLAKYLSIPAVFFWRYIPCDLDFKGTQCPNPSSYIPKLLTTNSDHMTFLQRVKNMLYPLALSYICH
TFSAPYASLASELFQREVSVVDLVSYASVWLFRGDFVMDYPRPIMPNMVFIGGINCANGKPLSQEFEAYINASGE
HGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAG
SHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKD
RPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRV
KKAHKSKTH

Structural information

Interpro:	IPR002213 IPR035595
Prosite:	PS00375
STRING:	ENSP00000362508

Other Databases

GeneCards: UGT1A4 Malacards: UGT1A4

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0008194	UDP-glycosyltransferase a ctivity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0016757	transferase activity, tra nsferring glycosyl groups	IEA	molecular function
GO:0015020	glucuronosyltransferase a ctivity	IEA	molecular function
GO:0042167	heme catabolic process	TAS	biological process
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0006789	bilirubin conjugation	TAS	biological process
GO:0052695	cellular glucuronidation	TAS	biological process
GO:0001972	retinoic acid binding	IDA	NOT\|molecular function
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular component
GO:0015020	glucuronosyltransferase a ctivity	IDA	molecular function
GO:0015020	glucuronosyltransferase a ctivity	IDA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0052695	cellular glucuronidation	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0019899	enzyme binding	IPI	molecular function

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00983	Drug metabolism - other enzymes
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00982	Drug metabolism - cytochrome P450
hsa00830	Retinol metabolism
hsa00140	Steroid hormone biosynthesis
hsa00860	Porphyrin and chlorophyll metabolism
hsa00040	Pentose and glucuronate interconversions
hsa00053	Ascorbate and aldarate metabolism

Diseases

Expand All | Collapse All

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
17327269	Teratozoos permia	13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
28606200	Cryptorchi dism	Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract
28606200	Cryptorchi dism	Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All