• Gene id: 54468

Gene Summary

• Gene Symbol: MIOS   Gene   UCSC   Ensembl
• Aliases: MIO, Sea4, Yulink
• Gene name: meiosis regulator for oocyte development
• Alternate names: GATOR complex protein MIOS, H_DJ1159O04.1, WD repeat-containing protein mio, WUGSC:H_DJ1159O04.1, missing oocyte, meiosis regulator, homolog,
• Gene location: 7p21.3 (85577534: 85582030)     Exons: 4     NC_000002.12
• OMIM: 615359

Protein Summary

• Protein general information: Q9NXC5  
  • Name: GATOR complex protein MIOS (Missing oocyte meiosis regulator homolog)
  • Length: 875  
  • Mass: 98584
• Sequence:

  MSGTKPDILWAPHHVDRFVVCDSELSLYHVESTVNSELKAGSLRLSEDSAATLLSINSDTPYMKCVAWYLNYDPE
  CLLAVGQANGRVVLTSLGQDHNSKFKDLIGKEFVPKHARQCNTLAWNPLDSNWLAAGLDKHRADFSVLIWDICSK
  YTPDIVPMEKVKLSAGETETTLLVTKPLYELGQNDACLSLCWLPRDQKLLLAGMHRNLAIFDLRNTSQKMFVNTK
  AVQGVTVDPYFHDRVASFYEGQVAIWDLRKFEKPVLTLTEQPKPLTKVAWCPTRTGLLATLTRDSNIIRLYDMQH
  TPTPIGDETEPTIIERSVQPCDNYIASFAWHPTSQNRMIVVTPNRTMSDFTVFERISLAWSPITSLMWACGRHLY
  ECTEEENDNSLEKDIATKMRLRALSRYGLDTEQVWRNHILAGNEDPQLKSLWYTLHFMKQYTEDMDQKSPGNKGS
  LVYAGIKSIVKSSLGMVESSRHNWSGLDKQSDIQNLNEERILALQLCGWIKKGTDVDVGPFLNSLVQEGEWERAA
  AVALFNLDIRRAIQILNEGASSEKGDLNLNVVAMALSGYTDEKNSLWREMCSTLRLQLNNPYLCVMFAFLTSETG
  SYDGVLYENKVAVRDRVAFACKFLSDTQLNRYIEKLTNEMKEAGNLEGILLTGLTKDGVDLMESYVDRTGDVQTA
  SYCMLQGSPLDVLKDERVQYWIENYRNLLDAWRFWHKRAEFDIHRSKLDPSSKPLAQVFVSCNFCGKSISYSCSA
  VPHQGRGFSQYGVSGSPTKSKVTSCPGCRKPLPRCALCLINMGTPVSSCPGGTKSDEKVDLSKDKKLAQFNNWFT
  WCHNCRHGGHAGHMLSWFRDHAECPVSACTCKCMQLDTTGNLVPAETVQP

• Structural information:
  • Interpro: IPR037593  IPR015943  IPR001680  IPR036322  IPR031488  
  • DIP: 53801
  • STRING: ENSP00000339881
• Other Databases: GeneCards:  MIOS  Malacards:  MIOS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032008	positive regulation of TOR signaling	IBA	biological process
GO:0034198	cellular response to amino acid starvation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0061700	GATOR2 complex	IDA	cellular component
GO:0032008	positive regulation of TOR signaling	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005765	lysosomal membrane	HDA	cellular component
GO:0034198	cellular response to amino acid starvation	IMP	biological process
GO:0034629	cellular protein-containing complex localization	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04150	mTOR signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)