• Gene id: 54466

Gene Summary

• Gene Symbol: SPIN2A   Gene   UCSC   Ensembl
• Aliases: DXF34, SPIN2, TDRD25, dJ323P24.1
• Gene name: spindlin family member 2A
• Alternate names: spindlin-2A, centromeric spin2 copy, spindlin homolog 2, spindlin-like protein 2, spindlin-like protein 2A,
• Gene location: Xp11.21 (57138687: 57133042)     Exons: 6     NC_000023.11
• Gene summary(Entrez): This gene encodes one of three members of the DXF34 gene family, located in a 100-kb region of chromosome Xp11.21. [provided by RefSeq, Nov 2009]
• OMIM: 605262

Protein Summary

• Protein general information: Q99865  
  • Name: Spindlin 2A (Protein DXF34) (Spindlin like protein 2A) (SPIN 2) (SPIN 2A)
  • Length: 258  
  • Mass: 29188
• Sequence:

  MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKEGDEPITQWKGTVLDQ
  VPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHISDANLANTIIGKAVEHMFEGEHGSKDEWRGM
  VLAQAPIMKAWFYITYEKDPVLYMYQLLDDYKEGDLRIMPESSESPPTEREPGGVVDGLIGKHVEYTKEDGSKRI
  GMVIHQVETKPSVYFIKFDDDFHIYVYDLVKKS

• Structural information:
  • Interpro: IPR029564  IPR003671  IPR042567  
  • STRING: ENSP00000364043
• Other Databases: GeneCards:  SPIN2A  Malacards:  SPIN2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005654	nucleoplasm	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0035064	methylated histone binding	IBA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0035064	methylated histone binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007276	gamete generation	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881