• Gene id: 54207

Gene Summary

• Gene Symbol: KCNK10   Gene   UCSC   Ensembl
• Aliases: K2p10.1, PPP1R97, TREK-2, TREK2
• Gene name: potassium two pore domain channel subfamily K member 10
• Alternate names: potassium channel subfamily K member 10, 2P domain potassium channel TREK2, TREK-2 K(+) channel subunit, TWIK-related K+ channel 2, outward rectifying potassium channel protein TREK-2, potassium channel TREK-2, potassium channel, subfamily K, member 10, potassiu,
• Gene location: 14q31.3 (88326911: 88180107)     Exons: 18     NC_000014.9
• Gene summary(Entrez): The protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming P domains. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations, and is stimulated s
• OMIM: 605873

Protein Summary

• Protein general information: P57789  
  • Name: Potassium channel subfamily K member 10 (Outward rectifying potassium channel protein TREK 2) (TREK 2 K(+) channel subunit)
  • Length: 538  
  • Mass: 59765
  • Tissue specificity: Abundantly expressed in pancreas and kidney and to a lower level in brain, testis, colon, and small intestine. Isoform b is strongly expressed in kidney (primarily in the proximal tubule) and pancreas, whereas isoform c is abundantly e
• Sequence:

  MFFLYTDFFLSLVAVPAAAPVCQPKSATNGQPPAPAPTPTPRLSISSRATVVARMEGTSQGGLQTVMKWKTVVAI
  FVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVSPQELETLIQHALDADNAGVSPIGNSSNNSS
  HWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRKKQ
  VSQTKIRVISTILFILAGCIVFVTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLV
  WFWILVGLAYFAAVLSMIGDWLRVLSKKTKEEVGEIKAHAAEWKANVTAEFRETRRRLSVEIHDKLQRAATIRSM
  ERRRLGLDQRAHSLDMLSPEKRSVFAALDTGRFKASSQESINNRPNNLRLKGPEQLNKHGQGASEDNIINKFGST
  SRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELENGMIPTDTKD
  REPENNSLLEDRN

• Structural information:
  • Interpro: IPR003280  IPR003976  IPR013099  
  • PDB: 4BW5 4XDJ 4XDK 4XDL
  • PDBsum: 4BW5 4XDJ 4XDK 4XDL
  • DIP: 44050
  • STRING: ENSP00000312811
• Other Databases: GeneCards:  KCNK10  Malacards:  KCNK10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022841	potassium ion leak channel activity	IBA	molecular function
GO:0071805	potassium ion transmembrane transport	IBA	biological process
GO:0030322	stabilization of membrane potential	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0005267	potassium channel activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0005267	potassium channel activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006813	potassium ion transport	IEA	biological process
GO:0071805	potassium ion transmembrane transport	IEA	biological process
GO:0005267	potassium channel activity	TAS	molecular function
GO:0007165	signal transduction	NAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005267	potassium channel activity	IEA	molecular function
GO:0007613	memory	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04971	Gastric acid secretion

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray