• Gene id: 54097

Gene Summary

• Gene Symbol: FAM3B   Gene   UCSC   Ensembl
• Aliases: 2-21, C21orf11, C21orf76, ORF9, PANDER, PRED44
• Gene name: FAM3 metabolism regulating signaling molecule B
• Alternate names: protein FAM3B, D21M16SJHU19e, cytokine-like protein 2-21, family with sequence similarity 3 member B, pancreatic derived factor,
• Gene location: 21q22.3 (41304228: 41357726)     Exons: 11     NC_000021.9
• OMIM: 608617

Protein Summary

• Protein general information: P58499  
  • Name: Protein FAM3B (Cytokine like protein 2 21) (Pancreatic derived factor) (PANDER)
  • Length: 235  
  • Mass: 25982
  • Tissue specificity: Highly expressed in the pancreas. Also found in the colon, kidney, prostate, small intestine and testis. {ECO
• Sequence:

  MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYA
  YRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSL
  LFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQ
  IEGCIPKERS

• Structural information:
  • Interpro: IPR039220  IPR039214  IPR039477  
  • STRING: ENSP00000350673
• Other Databases: GeneCards:  FAM3B  Malacards:  FAM3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030073	insulin secretion	IBA	biological process
GO:0030073	insulin secretion	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030073	insulin secretion	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0030073	insulin secretion	IDA	biological process
GO:0005576	extracellular region	NAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005125	cytokine activity	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881