• Gene id: 54039

Gene Summary

• Gene Symbol: PCBP3   Gene   UCSC   Ensembl
• Aliases: ALPHA-CP3, PCBP3-OT1, PCBP3OT
• Gene name: poly(rC) binding protein 3
• Alternate names: poly(rC)-binding protein 3, PCBP3 overlapping transcript 1, PCBP3-overlapping transcript, poly(rC) binding protein 3 overlapping transcript,
• Gene location: 21q22.3 (57488823: 57472261)     Exons: 22     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and h
• OMIM: 608502

Protein Summary

• Protein general information: P57721  
  • Name: Poly(rC) binding protein 3 (Alpha CP3) (PCBP3 overlapping transcript) (PCBP3 overlapping transcript 1)
  • Length: 371  
  • Mass: 39465
• Sequence:

  MGEGDAFWAPSVLPHSTLSTLSHHPQPQFGRRMESKVSEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKKMREES
  GARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGS
  KIKEIRESTGAQVQVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPKPASTPVIFAGGQ
  AYTIQGQYAIPHPDQLTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI
  PNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQITITGTPANISLAQYLINARLTSEVTGMGTL

• Structural information:
  • Protein Domains: (45..9-)
    (/note="KH-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117-)
    (129..18-)
    (/note="KH-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117-)
    (293..35-)
    (/note="KH-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117"-)
  • Interpro: IPR004087  IPR004088  IPR036612  
  • Prosite: PS50084
  • STRING: ENSP00000383168
• Other Databases: GeneCards:  PCBP3  Malacards:  PCBP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003729	mRNA binding	IBA	molecular function
GO:0051252	regulation of RNA metabolic process	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:1990829	C-rich single-stranded DNA binding	IEA	molecular function
GO:0003690	double-stranded DNA binding	IEA	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003723	RNA binding	NAS	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005634	nucleus	HDA	cellular component
GO:0016071	mRNA metabolic process	NAS	biological process
GO:0005829	cytosol	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq