Search Result
| Gene id | 5375 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary SNPs Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | PMP2 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | CMT1G, FABP8, M-FABP, MP2, P2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | peripheral myelin protein 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | myelin P2 protein, | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
8q21.13 (81447438: 81440325) Exons: 4 NC_000008.11 |
||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene localizes to myelin sheaths of the peripheral nervous system. The encoded protein can bind both the membrane layers of the sheaths and monomeric lipids, and is thought to provide stability to the sheath. A defect in this g |
||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 170715 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
SNPs |
rs7811653 Strand: Allele origin: Allele change: Mutation type: snv NC_000007.14 g.46362671C>A NC_000007.13 g.46402269C>A|SEQ=[C/A] rs4541736 Strand: Allele origin: Allele change: Mutation type: snv NC_000006.12 g.40722258C>A NC_000006.12 g.40722258C>G NC_000006.12 g.40722258C>T NC_000006.11 g.40689997C>A NC_000006.11 g.40689997C>G NC_000006.11 g.40689997C>T|SEQ=[C/A/G/T]|GENE=LOC105375052 |
||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | P02689 Name: Myelin P2 protein (Peripheral myelin protein 2) Length: 132 Mass: 14909 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETT ADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: PMP2  Malacards: PMP2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||