• Gene id: 53407

Gene Summary

• Gene Symbol: STX18   Gene   UCSC   Ensembl
• Aliases: Ufe1
• Gene name: syntaxin 18
• Alternate names: syntaxin-18, cell growth-inhibiting gene 9 protein,
• Gene location: 4p16.3-p16.2 (141487026: 141615355)     Exons: 30     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the syntaxin family of soluble N-ethylmaleimide-sensitive factor attachment protein receptors (SNAREs) which is part of a membrane tethering complex that includes other SNAREs and several peripheral membrane proteins, and is
• OMIM: 606046

Protein Summary

• Protein general information: Q9P2W9  
  • Name: Syntaxin 18 (Cell growth inhibiting gene 9 protein)
  • Length: 335  
  • Mass: 38674
  • Tissue specificity: Ubiquitous.
• Sequence:

  MAVDITLLFRASVKTVKTRNKALGVAVGGGVDGSRDELFRRSPRPKGDFSSRAREVISHIGKLRDFLLEHRKDYI
  NAYSHTMSEYGRMTDTERDQIDQDAQIFMRTCSEAIQQLRTEAHKEIHSQQVKEHRTAVLDFIEDYLKRVCKLYS
  EQRAIRVKRVVDKKRLSKLEPEPNTKTRESTSSEKVSQSPSKDSEENPATEERPEKILAETQPELGTWGDGKGED
  ELSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGRVVEISRLQEIFTEKVLQQEAEIDSIHQLVVGATENIKEGNE
  DIREAIKNNAGFRVWILFFLVMCSFSLLFLDWYDS

• Structural information:
  • Protein Domains: (243..30-)
    homology" (/note="t-SNARE-coiled-coil)
  • Interpro: IPR019529  IPR006012  
  • Prosite: PS00914
  • DIP: 37617
  • STRING: ENSP00000305810
• Other Databases: GeneCards:  STX18  Malacards:  STX18

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031201	SNARE complex	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IBA	biological process
GO:0005484	SNAP receptor activity	IEA	molecular function
GO:0006886	intracellular protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0061025	membrane fusion	IEA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:1902117	positive regulation of organelle assembly	IMP	biological process
GO:0090158	endoplasmic reticulum membrane organization	IMP	biological process
GO:1902953	positive regulation of ER to Golgi vesicle-mediated transport	IMP	biological process
GO:1902953	positive regulation of ER to Golgi vesicle-mediated transport	IMP	biological process
GO:1903358	regulation of Golgi organization	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04145	Phagosome
hsa04130	SNARE interactions in vesicular transport

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray