• Gene id: 53354

Gene Summary

• Gene Symbol: PANK1   Gene   UCSC   Ensembl
• Aliases: PANK
• Gene name: pantothenate kinase 1
• Alternate names: pantothenate kinase 1, pantothenic acid kinase 1,
• Gene location: 10q23.31 (89645571: 89579494)     Exons: 12     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the pantothenate kinase family. Pantothenate kinases are key regulatory enzymes in the biosynthesis of coenzyme A (CoA). The encoded protein catalyzes the first and rate-limiting enzymatic reaction in CoA biosynthesis and is

Protein Summary

• Protein general information: Q8TE04  
  • Name: Pantothenate kinase 1 (hPanK) (hPanK1) (EC 2.7.1.33) (Pantothenic acid kinase 1)
  • Length: 598  
  • Mass: 64339
  • Tissue specificity: [Isoform 1]
• Sequence:

  MLKLVGGGGGQDWACSVAGTSLGGEEAAFEVARPGDQGKAGGGSPGWGCAGIPDSAPGAGVLQAGAVGPARGGQG
  AEEVGESAGGGEERRVRHPQAPALRLLNRKPQGGSGEIKTPENDLQRGRLSRGPRTAPPAPGMGDRSGQQERSVP
  HSPGAPVGTSAAAVNGLLHNGFHPPPVQPPHVCSRGPVGGSDAAPQRLPLLPELQPQPLLPQHDSPAKKCRLRRR
  MDSGRKNRPPFPWFGMDIGGTLVKLVYFEPKDITAEEEQEEVENLKSIRKYLTSNTAYGKTGIRDVHLELKNLTM
  CGRKGNLHFIRFPSCAMHRFIQMGSEKNFSSLHTTLCATGGGAFKFEEDFRMIADLQLHKLDELDCLIQGLLYVD
  SVGFNGKPECYYFENPTNPELCQKKPYCLDNPYPMLLVNMGSGVSILAVYSKDNYKRVTGTSLGGGTFLGLCCLL
  TGCETFEEALEMAAKGDSTNVDKLVKDIYGGDYERFGLQGSAVASSFGNMMSKEKRDSISKEDLARATLVTITNN
  IGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGALLELFKMTDDK

• Structural information:
  • Interpro: IPR004567  
  • PDB: 2I7N 3SMP
  • PDBsum: 2I7N 3SMP
  • STRING: ENSP00000302108
• Other Databases: GeneCards:  PANK1  Malacards:  PANK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0015937	coenzyme A biosynthetic process	IBA	biological process
GO:0004594	pantothenate kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0015937	coenzyme A biosynthetic process	IEA	biological process
GO:0004594	pantothenate kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0015937	coenzyme A biosynthetic process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004594	pantothenate kinase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0071944	cell periphery	IEA	cellular component
GO:0015937	coenzyme A biosynthetic process	IEA	biological process
GO:0004594	pantothenate kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0015937	coenzyme A biosynthetic process	IEA	biological process
GO:1905502	acetyl-CoA binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00770	Pantothenate and CoA biosynthesis

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray