Search Result
| Gene id | 53344 | ||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||
| Gene Symbol | CHIC1 Gene UCSC Ensembl | ||||||||||||||||||||
| Aliases | BRX | ||||||||||||||||||||
| Gene name | cysteine rich hydrophobic domain 1 | ||||||||||||||||||||
| Alternate names | cysteine-rich hydrophobic domain-containing protein 1, brain X-linked protein, | ||||||||||||||||||||
| Gene location |
Xq13.2 (73563044: 73687108) Exons: 9 NC_000023.11 |
||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a cysteine-rich hydrophobic (CHIC) domain-containing protein, and is one of the few protein-coding genes found near the X-inactivation center. Studies in mouse indicate that the mouse ortholog of this gene is subject to X-inactivation in |
||||||||||||||||||||
| OMIM | 300922 | ||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||
| Protein general information | Q5VXU3 Name: Cysteine rich hydrophobic domain containing protein 1 (Brain X linked protein) Length: 224 Mass: 25616 Tissue specificity: Equally expressed in various parts of the brain. {ECO | ||||||||||||||||||||
| Sequence |
MSILLPNMAEFDTISELEEEEEEEAATSSSSPSSSSSVSGPDDDEEDEEEEEEEEEEEEEEEEEEEEEAPPPPRV VSEEHLRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAPEEFKTSIGRVNACLKKALPVNVKWLLCGCL CCCCTLGCSLWPVICLNKRTRRSIQKLIEWENNRLYHKLALHWKLTKRKCETSNMMEYVILIEFLPKYPIFRPD | ||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||
| Other Databases | GeneCards: CHIC1  Malacards: CHIC1 | ||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||
| |||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||
| |||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||
| |||||||||||||||||||||