• Gene id: 5225

Gene Summary

• Gene Symbol: PGC   Gene   UCSC   Ensembl
• Aliases: PEPC, PGII
• Gene name: progastricsin
• Alternate names: gastricsin, pepsin C, pepsinogen C, pepsinogen group II, preprogastricsin,
• Gene location: 6p21.1 (45163924: 45188016)     Exons: 12     NC_000022.11
• Gene summary(Entrez): This gene encodes an aspartic proteinase that belongs to the peptidase family A1. The encoded protein is a digestive enzyme that is produced in the stomach and constitutes a major component of the gastric mucosa. This protein is also secreted into the ser
• OMIM: 169740

Protein Summary

• Protein general information: P20142  
  • Name: Gastricsin (EC 3.4.23.3) (Pepsinogen C)
  • Length: 388  
  • Mass: 42426
• Sequence:

  MKWMVVVLVCLQLLEAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMDAAYFG
  EISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQACTSHSRFNPSESSTYSTNGQTFSLQYGSGSLTGFFGYDTLTV
  QSIQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPALSVDEATTAMQGMVQEGALTSPVFSVYLSNQQGSSGGAV
  VFGGVDSSLYTGQIYWAPVTQELYWQIGIEEFLIGGQASGWCSEGCQAIVDTGTSLLTVPQQYMSALLQATGAQE
  DEYGQFLVNCNSIQNLPSLTFIINGVEFPLPPSSYILSNNGYCTVGVEPTYLSSQNGQPLWILGDVFLRSYYSVY
  DLGNNRVGFATAA

• Structural information:
  • Protein Domains: (73..38-)
    (/note="Peptidase-A1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01103"-)
  • Interpro: IPR001461  IPR001969  IPR012848  IPR033121  IPR021109  
  • Prosite: PS00141 PS51767
  • PDB: 1AVF 1HTR
  • PDBsum: 1AVF 1HTR
  • STRING: ENSP00000362116
• Other Databases: GeneCards:  PGC  Malacards:  PGC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004190	aspartic-type endopeptidase activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0006508	proteolysis	IBA	biological process
GO:0030163	protein catabolic process	IBA	biological process
GO:0004190	aspartic-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004190	aspartic-type endopeptidase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0007586	digestion	IEA	biological process
GO:0004190	aspartic-type endopeptidase activity	TAS	molecular function
GO:0007586	digestion	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0006508	proteolysis	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0002803	positive regulation of antibacterial peptide production	IMP	biological process
GO:0004190	aspartic-type endopeptidase activity	IMP	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)