• Gene id: 5222

Gene Summary

• Gene Symbol: PGA5   Gene   UCSC   Ensembl
• Aliases: Pg5
• Gene name: pepsinogen A5
• Alternate names: pepsin A-5, Pepsin A-4, Pepsinogen-4, pepsin A, pepsinogen 5, group I (pepsinogen A), pepsinogen-5,
• Gene location: 11q12.2 (61241174: 61251443)     Exons: 9     NC_000011.10
• Gene summary(Entrez): This gene encodes a protein precursor of the digestive enzyme pepsin, a member of the peptidase A1 family of endopeptidases. The encoded precursor is secreted by gastric chief cells and undergoes autocatalytic cleavage in acidic conditions to form the act
• OMIM: 605038

Protein Summary

• Protein general information: P0DJD9  
  • Name: Pepsin A 5 (EC 3.4.23.1) (Pepsinogen 5)
  • Length: 388  
  • Mass: 41993
• Sequence:

  MKWLLLLGLVALSECIMYKVPLIRKKSLRRTLSERGLLKDFLKKHNLNPARKYFPQWEAPTLVDEQPLENYLDME
  YFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDT
  VQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDKSGS
  VVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGETIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGAS
  ENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQSEGSCISGFQGMNVPTESGELWILGDVFIRQYFTVF
  DRANNQVGLAPVA

• Structural information:
  • Protein Domains: (76..38-)
    (/note="Peptidase-A1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01103"-)
  • Interpro: IPR001461  IPR001969  IPR012848  IPR034162  IPR033121   IPR021109  
  • Prosite: PS00141 PS51767
  • CDD: cd05478
  • STRING: ENSP00000309542
• Other Databases: GeneCards:  PGA5  Malacards:  PGA5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IBA	biological process
GO:0004190	aspartic-type endopeptidase activity	IBA	molecular function
GO:0030163	protein catabolic process	IBA	biological process
GO:0004190	aspartic-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0004190	aspartic-type endopeptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0007586	digestion	IEA	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0097486	multivesicular body lumen	TAS	cellular component
GO:0097486	multivesicular body lumen	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04974	Protein digestion and absorption

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R