|
Gene id |
5203 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
PFDN4 Gene UCSC Ensembl |
|
Aliases |
C1, PFD4 |
|
Gene name |
prefoldin subunit 4 |
|
Alternate names |
prefoldin subunit 4, prefoldin 4, protein C-1, |
|
Gene location |
20q13.2 (54208086: 54219960) Exons: 5 NC_000020.11
|
|
Gene summary(Entrez) |
This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The
|
|
OMIM |
604898 |
Protein Summary
|
| Protein general information
| Q9NQP4
Name: Prefoldin subunit 4 (Protein C 1)
Length: 134 Mass: 15314
|
| Sequence |
MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVF ISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES
|
| Structural information |
|
| Other Databases |
GeneCards: PFDN4  Malacards: PFDN4 |
|
|
|
|
| Associated diseases |
References |
| Aberrant CpGs in Low Motility Sperm | MIK: 21674046 |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
13 (5 controls, 8 cases)
|
Male infertility |
GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 17327269 |
Teratozoos permia
|
|
|
19 (6 controls , 13 cases)
|
Male infertility |
GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 21674046 |
Aberrant C pGs in Low Motility Sperm
|
|
|
18
|
Male infertility |
GSE26881
|
Show abstract |
|