• Gene id: 5202

Gene Summary

• Gene Symbol: PFDN2   Gene   UCSC   Ensembl
• Aliases: PFD2
• Gene name: prefoldin subunit 2
• Alternate names: prefoldin subunit 2, prefoldin 2,
• Gene location: 1q23.3 (96783434: 96785614)     Exons: 4     NC_000015.10
• Gene summary(Entrez): This gene encodes a member of the prefoldin beta subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The
• OMIM: 613466

Protein Summary

• Protein general information: Q9UHV9  
  • Name: Prefoldin subunit 2
  • Length: 154  
  • Mass: 16648
• Sequence:

  MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVG
  GVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAG
  VLVS

• Structural information:
  • Interpro: IPR027235  IPR002777  IPR009053  
  • PDB: 6NR8 6NR9 6NRB 6NRC 6NRD
  • PDBsum: 6NR8 6NR9 6NRB 6NRC 6NRD
  • DIP: 27557
  • STRING: ENSP00000356989
• Other Databases: GeneCards:  PFDN2  Malacards:  PFDN2

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)