• Gene id: 5184

Gene Summary

• Gene Symbol: PEPD   Gene   UCSC   Ensembl
• Aliases: PROLIDASE
• Gene name: peptidase D
• Alternate names: xaa-Pro dipeptidase, X-Pro dipeptidase, aminoacyl-L-proline hydrolase, imidodipeptidase, proline dipeptidase, testicular tissue protein Li 138,
• Gene location: 19q13.11 (33521790: 33386949)     Exons: 8     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the peptidase family. The protein forms a homodimer that hydrolyzes dipeptides or tripeptides with C-terminal proline or hydroxyproline residues. The enzyme serves an important role in the recycling of proline, and may be rat
• OMIM: 613230

Protein Summary

• Protein general information: P12955  
  • Name: Xaa Pro dipeptidase (X Pro dipeptidase) (EC 3.4.13.9) (Imidodipeptidase) (Peptidase D) (Proline dipeptidase) (Prolidase)
  • Length: 493  
  • Mass: 54548
• Sequence:

  MAAATGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSIVVLQGGEETQRYCTDTGVLFRQESFFHWAF
  GVTEPGCYGVIDVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQKPSVLLTLRGV
  NTDSGSVCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESL
  FEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTA
  DQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGSVDAMVQAHLGAVFMPHGLGHFLGID
  VHDVGGYPEGVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDHLLDEALADPARASFLNREVLQRFRGFGGVR
  IEEDVVVTDSGIELLTCVPRTVEEIEACMAGCDKAFTPFSGPK

• Structural information:
  • Interpro: IPR007865  IPR029149  IPR036005  IPR000994  IPR001131  
  • Prosite: PS00491
  • PDB: 2IW2 2OKN 5M4G 5M4J 5M4L 5M4Q 5MBY 5MBZ 5MC0 5MC1 5MC2 5MC3 5MC4 5MC5 6H2P 6H2Q
  • PDBsum: 2IW2 2OKN 5M4G 5M4J 5M4L 5M4Q 5MBY 5MBZ 5MC0 5MC1 5MC2 5MC3 5MC4 5MC5 6H2P 6H2Q
  • DIP: 50038
  • STRING: ENSP00000244137
• Other Databases: GeneCards:  PEPD  Malacards:  PEPD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008233	peptidase activity	IBA	molecular function
GO:0004177	aminopeptidase activity	IEA	molecular function
GO:0030145	manganese ion binding	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0030574	collagen catabolic process	IEA	biological process
GO:0016805	dipeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0004181	metallocarboxypeptidase activity	TAS	molecular function
GO:0006520	cellular amino acid metabolic process	TAS	biological process
GO:0006508	proteolysis	TAS	biological process
GO:0102009	proline dipeptidase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Prolidase deficiency	KEGG:H01119
Prolidase deficiency	KEGG:H01119
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R