• Gene id: 51754

Gene Summary

• Gene Symbol: TMEM8B   Gene   UCSC   Ensembl
• Aliases: C9orf127, FP588, LINC00950, NAG-5, NAG5, NGX6, NGX6a
• Gene name: transmembrane protein 8B
• Alternate names: transmembrane protein 8B, nasopharyngeal carcinoma expressed 6, nasopharyngeal carcinoma related protein, nasopharyngeal carcinoma-associated gene 6 protein,
• Gene location: 9p13.3 (35825816: 35865514)     Exons: 19     NC_000009.12
• OMIM: 138890

Protein Summary

• Protein general information: A6NDV4  
  • Name: Transmembrane protein 8B (Nasopharyngeal carcinoma associated gene 6 protein) (Protein NAG 5) (Protein NGX6)
  • Length: 472  
  • Mass: 51941
• Sequence:

  MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAVFAMRL
  LPVLDSGGVLSLELQLNASSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRVARLRIPFPQT
  GTWFLALRSLCGVGPRFVRCRNATAEVRMRTFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSAD
  ALTYGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTFYHACDQPGIVVFCIMDYDVLQFCDFL
  GSLMSVWVTVIAMARLQPVVKQVLYLLGAMLLSMALQLDRHGLWNLLGPSLFALGILATAWTVRSVRRRHCYPPT
  WRRWLFYLCPGSLIAGSAVLLYAFVETRDNYFYIHSIWHMLIAGSVGFLLPPRAKTDHGVPSGARARGCGYQLCI
  NEQEELGLVGPGGATVSSICAS

• Structural information:
  • Protein Domains: (182..22-)
    (/note="EGF-like"-)
  • Interpro: IPR013032  IPR021910  
  • Prosite: PS00022 PS01186
  • STRING: ENSP00000367227
• Other Databases: GeneCards:  TMEM8B  Malacards:  TMEM8B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007346	regulation of mitotic cell cycle	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0040008	regulation of growth	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq