• Gene id: 51747

Gene Summary

• Gene Symbol: LUC7L3   Gene   UCSC   Ensembl
• Aliases: CRA, CREAP-1, CROP, LUC7A, OA48-18, hLuc7A
• Gene name: LUC7 like 3 pre-mRNA splicing factor
• Alternate names: luc7-like protein 3, CRE-associated protein 1, LUC7-like 3, cAMP regulatory element-associated protein 1, cisplatin resistance-associated-overexpressed protein, okadaic acid-inducible phosphoprotein OA48-18,
• Gene location: 17q21.33 (50719564: 50756218)     Exons: 16     NC_000017.11
• Gene summary(Entrez): This gene encodes a protein with an N-terminal half that contains cysteine/histidine motifs and leucine zipper-like repeats, and the C-terminal half is rich in arginine and glutamate residues (RE domain) and arginine and serine residues (RS domain). This
• OMIM: 609434

Protein Summary

• Protein general information: O95232  
  • Name: Luc7 like protein 3 (Cisplatin resistance associated overexpressed protein) (Luc7A) (Okadaic acid inducible phosphoprotein OA48 18) (cAMP regulatory element associated protein 1) (CRE associated protein 1) (CREAP 1)
  • Length: 432  
  • Mass: 51466
  • Tissue specificity: Widely expressed. Highest levels in heart, brain, pancreas, thymus, ovary, small intestine and peripheral blood leukocytes, as well as cerebellum, putamen and pituitary gland. Lowest levels in lung, liver and kidney. Also expressed in
• Sequence:

  MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSR
  FMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEG
  KVEEAQGMMKLVEQLKEERELLRSTTSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKA
  TVEELKEKLRKRTEEPDRDERLKKEKQEREEREKEREREREERERKRRREEEEREKERARDRERRKRSRSRSRHS
  SRTSDRRCSRSRDHKRSRSRERRRSRSRDRRRSRSHDRSERKHRSRSRDRRRSKSRDRKSYKHRSKSRDREQDRK
  SKEKEKRGSDDKKSSVKSGSREKQSEDTNTESKESDTKNEVNGTSEDIKSEGDTQSN

• Structural information:
  • Interpro: IPR004882  
  • STRING: ENSP00000425092
• Other Databases: GeneCards:  LUC7L3  Malacards:  LUC7L3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005685	U1 snRNP	IBA	cellular component
GO:0071004	U2-type prespliceosome	IBA	cellular component
GO:0003729	mRNA binding	IBA	molecular function
GO:0006376	mRNA splice site selection	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003729	mRNA binding	IEA	molecular function
GO:0006376	mRNA splice site selection	IEA	biological process
GO:0005685	U1 snRNP	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0016607	nuclear speck	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003729	mRNA binding	IMP	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0008380	RNA splicing	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq