• Gene id: 51702

Gene Summary

• Gene Symbol: PADI3   Gene   UCSC   Ensembl
• Aliases: PAD3, PDI3, UHS1
• Gene name: peptidyl arginine deiminase 3
• Alternate names: protein-arginine deiminase type-3, peptidyl arginine deiminase, type III, peptidylarginine deiminase III, protein-arginine deiminase type III,
• Gene location: 1p36.13 (17249078: 17284232)     Exons: 18     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distin
• OMIM: 608084

Protein Summary

• Protein general information: Q9ULW8  
  • Name: Protein arginine deiminase type 3 (EC 3.5.3.15) (Peptidylarginine deiminase III) (Protein arginine deiminase type III)
  • Length: 664  
  • Mass: 74743
  • Tissue specificity: Hair follicles, and epidermis at very low levels.
• Sequence:

  MSLQRIVRVSLEHPTSAVCVAGVETLVDIYGSVPEGTEMFEVYGTPGVDIYISPNMERGRERADTRRWRFDATLE
  IIVVMNSPSNDLNDSHVQISYHSSHEPLPLAYAVLYLTCVDISLDCDLNCEGRQDRNFVDKRQWVWGPSGYGGIL
  LVNCDRDDPSCDVQDNCDQHVHCLQDLEDMSVMVLRTQGPAALFDDHKLVLHTSSYDAKRAQVFHICGPEDVCEA
  YRHVLGQDKVSYEVPRLHGDEERFFVEGLSFPDAGFTGLISFHVTLLDDSNEDFSASPIFTDTVVFRVAPWIMTP
  STLPPLEVYVCRVRNNTCFVDAVAELARKAGCKLTICPQAENRNDRWIQDEMELGYVQAPHKTLPVVFDSPRNGE
  LQDFPYKRILGPDFGYVTREPRDRSVSGLDSFGNLEVSPPVVANGKEYPLGRILIGGNLPGSSGRRVTQVVRDFL
  HAQKVQPPVELFVDWLAVGHVDEFLSFVPAPDGKGFRMLLASPGACFKLFQEKQKCGHGRALLFQGVVDDEQVKT
  ISINQVLSNKDLINYNKFVQSCIDWNREVLKRELGLAECDIIDIPQLFKTERKKATAFFPDLVNMLVLGKHLGIP
  KPFGPIINGCCCLEEKVRSLLEPLGLHCTFIDDFTPYHMLHGEVHCGTNVCRKPFSFKWWNMVP

• Structural information:
  • Interpro: IPR008972  IPR004303  IPR013530  IPR036556  IPR013732   IPR038685  IPR013733  
  • PDB: 6CE1
  • PDBsum: 6CE1
  • STRING: ENSP00000364609
• Other Databases: GeneCards:  PADI3  Malacards:  PADI3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0036414	histone citrullination	IBA	biological process
GO:0004668	protein-arginine deiminase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0004668	protein-arginine deiminase activity	IMP	molecular function
GO:0018101	protein citrullination	IMP	biological process
GO:0004668	protein-arginine deiminase activity	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0018101	protein citrullination	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004668	protein-arginine deiminase activity	TAS	molecular function
GO:0004668	protein-arginine deiminase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006325	chromatin organization	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0036414	histone citrullination	IBA	biological process
GO:0004668	protein-arginine deiminase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0004668	protein-arginine deiminase activity	IMP	molecular function
GO:0018101	protein citrullination	IMP	biological process
GO:0004668	protein-arginine deiminase activity	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0018101	protein citrullination	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004668	protein-arginine deiminase activity	TAS	molecular function
GO:0004668	protein-arginine deiminase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006325	chromatin organization	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Uncombable hair syndrome	KEGG:H01796
Uncombable hair syndrome	KEGG:H01796
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881