• Gene id: 51667

Gene Summary

• Gene Symbol: NUB1   Gene   UCSC   Ensembl
• Aliases: BS4, NUB1L, NYREN18
• Gene name: negative regulator of ubiquitin like proteins 1
• Alternate names: NEDD8 ultimate buster 1, NEDD8 ultimate buster-1, renal carcinoma antigen NY-REN-18,
• Gene location: 7q36.1 (151341698: 151378460)     Exons: 17     NC_000007.14
• Gene summary(Entrez): This gene encodes a protein that functions as a negative regulator of NEDD8, a ubiquitin-like protein that conjugates with cullin family members in order to regulate vital biological events. The protein encoded by this gene regulates the NEDD8 conjugation
• OMIM: 607981

Protein Summary

• Protein general information: Q9Y5A7  
  • Name: NEDD8 ultimate buster 1 (Negative regulator of ubiquitin like proteins 1) (Renal carcinoma antigen NY REN 18)
  • Length: 615  
  • Mass: 70538
  • Tissue specificity: Widely expressed with lowest expression in the pancreas for isoform 1 and in leukocytes, liver, prostate and skeletal muscle for isoform 2.
• Sequence:

  MAQKKYLQAKLTQFLREDRIQLWKPPYTDENKKVGLALKDLAKQYSDRLECCENEVEKVIEEIRCKAIERGTGND
  NYRTTGIATIEVFLPPRLKKDRKNLLETRLHITGRELRSKIAETFGLQENYIKIVINKKQLQLGKTLEEQGVAHN
  VKAMVLELKQSEEDARKNFQLEEEEQNEAKLKEKQIQRTKRGLEILAKRAAETVVDPEMTPYLDIANQTGRSIRI
  PPSERKALMLAMGYHEKGRAFLKRKEYGIALPCLLDADKYFCECCRELLDTVDNYAVLQLDIVWCYFRLEQLECL
  DDAEKKLNLAQKCFKNCYGENHQRLVHIKGNCGKEKVLFLRLYLLQGIRNYHSGNDVEAYEYLNKARQLFKELYI
  DPSKVDNLLQLGFTAQEARLGLRACDGNVDHAATHITNRREELAQIRKEEKEKKRRRLENIRFLKGMGYSTHAAQ
  QVLHAASGNLDEALKILLSNPQMWWLNDSNPETDNRQESPSQENIDRLVYMGFDALVAEAALRVFRGNVQLAAQT
  LAHNGGSLPPELPLSPEDSLSPPATSPSDSAGTSSASTDEDMETEAVNEILEDIPEHEEDYLDSTLEDEEIIIAE
  YLSYVENRKSATKKN

• Structural information:
  • Protein Domains: (374..41-)
    (/note="UBA-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00212-)
    (424..47-)
    (/note="UBA-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00212-)
    (489..52-)
    (/note="UBA-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00212"-)
  • Interpro: IPR039749  IPR041207  IPR011990  IPR015940  IPR009060   IPR029071  
  • Prosite: PS50030
  • PDB: 1WJU
  • PDBsum: 1WJU
  • STRING: ENSP00000454264
• Other Databases: GeneCards:  NUB1  Malacards:  NUB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000058	regulation of ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0034612	response to tumor necrosis factor	IEP	biological process
GO:0034341	response to interferon-gamma	IEP	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0016567	protein ubiquitination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq