• Gene id: 51634

Gene Summary

• Gene Symbol: RBMX2   Gene   UCSC   Ensembl
• Aliases: CGI-79, Snu17
• Gene name: RNA binding motif protein, X-linked 2
• Alternate names: RNA-binding motif protein, X-linked 2,
• Gene location: Xq26.1 (130401948: 130413655)     Exons: 6     NC_000023.11
• OMIM: 0

Protein Summary

• Protein general information: Q9Y388  
  • Name: RNA binding motif protein, X linked 2
  • Length: 322  
  • Mass: 37,336
• Sequence:

  MNPLTKVKLINELNEREVQLGVADKVSWHSEYKDSAWIFLGGLPYELTEGDIICVFSQYGEIVNINLVRDKKTGK
  SKGFCFLCYEDQRSTILAVDNFNGIKIKGRTIRVDHVSNYRAPKDSEEIDDVTRQLQEKGCGARTPSPSLSESSE
  DEKPTKKHKKDKKEKKKKKKEKEKADREVQAEQPSSSSPRRKTVKEKDDTGPKKHSSKNSERAQKSEPREGQKLP
  KSRTAYSGGAEDLERELKKEKPKHEHKSSSRREAREEKTRIRDRGRSSDAHSSWYNGRSEGRSYRSRSRSRDKSH
  RHKRARRSRERESSNPSDRWRH

• Structural information:
  • Protein Domains: RRM. (36-114)
  • Interpro: IPR012677  IPR035979  IPR000504  
  • Prosite: PS50102
  • STRING: ENSP00000339090
• Other Databases: GeneCards:  RBMX2  Malacards:  RBMX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000398	mRNA splicing, via spliceosome	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005686	U2 snRNP	IBA	cellular component
GO:0006406	mRNA export from nucleus	IBA	biological process
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0070274	RES complex	IBA	cellular component
GO:0071011	precatalytic spliceosome	IBA	cellular component
GO:0071013	catalytic step 2 spliceosome	IBA	cellular component
GO:0000384	first spliceosomal transesterification activity	IBA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000398	mRNA splicing, via spliceosome	IBA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005686	U2 snRNP	IBA	cellular component
GO:0006406	mRNA export from nucleus	IBA	biological process
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0070274	RES complex	IBA	cellular component
GO:0071011	precatalytic spliceosome	IBA	cellular component
GO:0071013	catalytic step 2 spliceosome	IBA	cellular component
GO:0000384	first spliceosomal transesterification activity	IBA	molecular function
GO:0000398	mRNA splicing, via spliceosome	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005686	U2 snRNP	IBA	cellular component
GO:0006406	mRNA export from nucleus	IBA	biological process
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0070274	RES complex	IBA	cellular component
GO:0071011	precatalytic spliceosome	IBA	cellular component
GO:0071013	catalytic step 2 spliceosome	IBA	cellular component
GO:0000384	first spliceosomal transesterification activity	IBA	molecular function

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 26162009
Maturation arrest	MIK: 26162009
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Non- obstructive azoospermia, maturation arrest	MIK: 26162009
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26162009	Non- obstructive azoospermia, maturation arrest			80 (12 men with preserved spermatogenesis, 68 men with nonobstructive azoospermia (NOA) (40 Sertoli-cell-only syndrome (SCOS) and 28 premiotic maturation arrest (MA)))	Male infertility	USP9Y DDX3Y XKRY HSFY1 CYORF15A CYORF15B KDM5D EIF1AY RPS4Y2 RBMY1A1 PRY BPY2 DAZ1 and CDY1
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881