• Gene id: 51621

Gene Summary

• Gene Symbol: KLF13   Gene   UCSC   Ensembl
• Aliases: BTEB3, FKLF2, NSLP1, RFLAT-1, RFLAT1
• Gene name: Kruppel like factor 13
• Alternate names: Krueppel-like factor 13, BTE-binding protein 3, RANTES factor of late activated T lymphocytes-1, basic transcription element binding protein 3, novel Sp1-like zinc finger transcription factor 1, transcription factor BTEB3, transcription factor NSLP1,
• Gene location: 15q13.3 (31326834: 31435664)     Exons: 3     NC_000015.10
• Gene summary(Entrez): KLF13 belongs to a family of transcription factors that contain 3 classical zinc finger DNA-binding domains consisting of a zinc atom tetrahedrally coordinated by 2 cysteines and 2 histidines (C2H2 motif). These transcription factors bind to GC-rich seque
• OMIM: 142963

Protein Summary

• Protein general information: Q9Y2Y9  
  • Name: Krueppel like factor 13 (Basic transcription element binding protein 3) (BTE binding protein 3) (Novel Sp1 like zinc finger transcription factor 1) (RANTES factor of late activated T lymphocytes 1) (RFLAT 1) (Transcription factor BTEB3) (Transcription fac
  • Length: 288  
  • Mass: 31180
  • Tissue specificity: Ubiquitous.
• Sequence:

  MAAAAYVDHFAAECLVSMSSRAVVHGPREGPESRPEGAAVAATPTLPRVEERRDGKDSASLFVVARILADLNQQA
  PAPAPAERREGAAARKARTPCRLPPPAPEPTSPGAEGAAAAPPSPAWSEPEPEAGLEPEREPGPAGSGEPGLRQR
  VRRGRSRADLESPQRKHKCHYAGCEKVYGKSSHLKAHLRTHTGERPFACSWQDCNKKFARSDELARHYRTHTGEK
  KFSCPICEKRFMRSDHLTKHARRHANFHPGMLQRRGGGSRTGSLSDYSRSDASSPTISPASSP

• Structural information:
  • Interpro: IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • STRING: ENSP00000302456
• Other Databases: GeneCards:  KLF13  Malacards:  KLF13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045647	negative regulation of erythrocyte differentiation	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Chromosome 15q13.3 microdeletion syndrome	KEGG:H01877
Chromosome 15q13.3 microdeletion syndrome	KEGG:H01877
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881