Search Result
| Gene id | 51601 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | LIPT1 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | LIPT1D | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | lipoyltransferase 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | lipoyltransferase 1, mitochondrial, lipoate biosynthesis protein, lipoyl ligase, | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
2q11.2 (99154966: 99163156) Exons: 7 NC_000002.12 |
||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The process of transferring lipoic acid to proteins is a two-step process. The first step is the activation of lipoic acid by lipoate-activating enzyme to form lipoyl-AMP. For the second step, the protein encoded by this gene transfers the lipoyl moiety t |
||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 610284 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q9Y234 Name: Lipoyltransferase 1, mitochondrial (EC 2.3.1. ) (Lipoate biosynthesis protein) (Lipoate protein ligase) (Lipoyl ligase) Length: 373 Mass: 42479 Tissue specificity: Highly expressed in skeletal muscle and heart, moderately in kidney and pancreas, and detected at lower levels in liver, brain, placenta and lung. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MLIPFSMKNCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLEGKPILFFWQNSPSVVIG RHQNPWQECNLNLMREEGIKLARRRSGGGTVYHDMGNINLTFFTTKKKYDRMENLKLIVRALNAVQPQLDVQATK RFDLLLDGQFKISGTASKIGRTTAYHHCTLLCSTDGTFLSSLLKSPYQGIRSNATASIPSLVKNLLEKDPTLTCE VLMNAVATEYAAYHQIDNHIHLINPTDETLFPGINSKAKELQTWEWIYGKTPKFSINTSFHVLYEQSHLEIKVFI DIKNGRIEICNIEAPDHWLPLEIRDKLNSSLIGSKFCPTETTMLTNILLRTCPQDHKLNSKWNILCEKIKGIM | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: LIPT1  Malacards: LIPT1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
KEGG pathways
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||