• Gene id: 51573

Gene Summary

• Gene Symbol: GDE1   Gene   UCSC   Ensembl
• Aliases: 363E6.2, MIR16
• Gene name: glycerophosphodiester phosphodiesterase 1
• Alternate names: glycerophosphodiester phosphodiesterase 1, RGS16-interacting membrane protein, membrane interacting protein of RGS16,
• Gene location: 16p12.3 (19522097: 19501692)     Exons: 6     NC_000016.10
• OMIM: 605943

Protein Summary

• Protein general information: Q9NZC3  
  • Name: Glycerophosphodiester phosphodiesterase 1 (EC 3.1.4. ) (EC 3.1.4.44) (Membrane interacting protein of RGS16) (RGS16 interacting membrane protein)
  • Length: 331  
  • Mass: 37718
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MWLWEDQGGLLGPFSFLLLVLLLVTRSPVNACLLTGSLFVLLRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSH
  DAPENTLAAIRQAAKNGATGVELDIEFTSDGIPVLMHDNTVDRTTDGTGRLCDLTFEQIRKLNPAANHRLRNDFP
  DEKIPTLREAVAECLNHNLTIFFDVKGHAHKATEALKKMYMEFPQLYNNSVVCSFLPEVIYKMRQTDRDVITALT
  HRPWSLSHTGDGKPRYDTFWKHFIFVMMDILLDWSMHNILWYLCGISAFLMQKDFVSPAYLKKWSAKGIQVVGWT
  VNTFDEKSYYESHLGSSYITDSMVEDCEPHF

• Structural information:
  • Protein Domains: (65..33-)
    (/note="GP-PDE"-)
  • Interpro: IPR030395  IPR017946  
  • Prosite: PS51704
  • STRING: ENSP00000261386
• Other Databases: GeneCards:  GDE1  Malacards:  GDE1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004622	lysophospholipase activity	ISS	molecular function
GO:0006644	phospholipid metabolic process	ISS	biological process
GO:0070291	N-acylethanolamine metabolic process	ISS	biological process
GO:0008889	glycerophosphodiester phosphodiesterase activity	ISS	molecular function
GO:0070291	N-acylethanolamine metabolic process	ISS	biological process
GO:0006580	ethanolamine metabolic process	ISS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0047395	glycerophosphoinositol glycerophosphodiesterase activity	ISS	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0008081	phosphoric diester hydrolase activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0047395	glycerophosphoinositol glycerophosphodiesterase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0046475	glycerophospholipid catabolic process	TAS	biological process
GO:0047395	glycerophosphoinositol glycerophosphodiesterase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070291	N-acylethanolamine metabolic process	IEA	biological process
GO:0047395	glycerophosphoinositol glycerophosphodiesterase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0008081	phosphoric diester hydrolase activity	IEA	molecular function
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0004622	lysophospholipase activity	IEA	molecular function
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008889	glycerophosphodiester phosphodiesterase activity	TAS	molecular function
GO:0006629	lipid metabolic process	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)