Search Result
| Gene id | 5157 | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||
| Gene Symbol | PDGFRL Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||
| Aliases | PDGRL, PRLTS | ||||||||||||||||||||||||||||||||||||
| Gene name | platelet derived growth factor receptor like | ||||||||||||||||||||||||||||||||||||
| Alternate names | platelet-derived growth factor receptor-like protein, PDGF receptor beta-like tumor suppressor, PDGFR-like protein, platelet-derived growth factor-beta-like tumor suppressor, | ||||||||||||||||||||||||||||||||||||
| Gene location |
8p22 (17576432: 17643143) Exons: 7 NC_000008.11 |
||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a protein with significant sequence similarity to the ligand binding domain of platelet-derived growth factor receptor beta. Mutations in this gene, or deletion of a chromosomal segment containing this gene, are associated with sporadic |
||||||||||||||||||||||||||||||||||||
| OMIM | 617614 | ||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||
| Protein general information | Q15198 Name: Platelet derived growth factor receptor like protein (PDGFR like protein) (PDGF receptor beta like tumor suppressor) Length: 375 Mass: 41861 Tissue specificity: Expressed in colon, lung and liver. {ECO | ||||||||||||||||||||||||||||||||||||
| Sequence |
MKVWLLLGLLLVHEALEDVTGQHLPKNKRPKEPGENRIKPTNKKVKPKIPKMKDRDSANSAPKTQSIMMQVLDKG RFQKPAATLSLLAGQTVELRCKGSRIGWSYPAYLDTFKDSRLSVKQNERYGQLTLVNSTSADTGEFSCWVQLCSG YICRKDEAKTGSTYIFFTEKGELFVPSPSYFDVVYLNPDRQAVVPCRVTVLSAKVTLHREFPAKEIPANGTDIVY DMKRGFVYLQPHSEHQGVVYCRAEAGGRSQISVKYQLLYVAVPSGPPSTTILASSNKVKSGDDISVLCTVLGEPD VEVEFTWIFPGQKDERPVTIQDTWRLIHRGLGHTTRISQSVITVEDFETIDAGYYICTAQNLQGQTTVATTVEFS | ||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: PDGFRL  Malacards: PDGFRL | ||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||