• Gene id: 51566

Gene Summary

• Gene Symbol: ARMCX3   Gene   UCSC   Ensembl
• Aliases: ALEX3, GASP6, dJ545K15.2
• Gene name: armadillo repeat containing X-linked 3
• Alternate names: armadillo repeat-containing X-linked protein 3, 1200004E24Rik, ARM protein lost in epithelial cancers on chromosome X 3, arm protein lost in epithelial cancers, X chromosome, 3,
• Gene location: Xq22.1 (101623129: 101631909)     Exons: 6     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat ar
• OMIM: 300364

Protein Summary

• Protein general information: Q9UH62  
  • Name: Armadillo repeat containing X linked protein 3 (ARM protein lost in epithelial cancers on chromosome X 3) (Protein ALEX3)
  • Length: 379  
  • Mass: 42501
• Sequence:

  MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVW
  YPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNA
  AYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTITSRLNSSVQLAGL
  RLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE
  VILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFP
  KSQE

• Structural information:
  • Interpro: IPR011989  IPR006911  IPR016024  IPR000225  
  • Prosite: PS50176
  • STRING: ENSP00000340672
• Other Databases: GeneCards:  ARMCX3  Malacards:  ARMCX3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0034613	cellular protein localization	IEA	biological process
GO:0031307	integral component of mitochondrial outer membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)