• Gene id: 51564

Gene Summary

• Gene Symbol: HDAC7   Gene   UCSC   Ensembl
• Aliases: HD7, HD7A, HDAC7A
• Gene name: histone deacetylase 7
• Alternate names: histone deacetylase 7, histone deacetylase 7A,
• Gene location: 12q13.11 (47820611: 47782721)     Exons: 31     NC_000012.12
• Gene summary(Entrez): Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene h
• OMIM: 606542

Protein Summary

• Protein general information: Q8WUI4  
  • Name: Histone deacetylase 7 (HD7) (EC 3.5.1.98) (Histone deacetylase 7A) (HD7a)
  • Length: 952  
  • Mass: 102927
• Sequence:

  MDLRVGQRPPVEPPPEPTLLALQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVGPQEQELRQLLHKDKS
  KRSAVASSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPLETEGATRSMLSSFLPPVPSLPSDPPEHFPL
  RKTVSEPNLKLRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPNPILGS
  EALLGQRLRLQETSVAPFALPTVSLLPAITLGLPAPARADSDRRTHPTLGPRGPILGSPHTPLFLPHGLEPEAGG
  TLPSRLQPILLLDPSGSHAPLLTVPGLGPLPFHFAQSLMTTERLSGSGLHWPLSRTRSEPLPPSATAPPPPGPMQ
  PRLEQLKTHVQVIKRSAKPSEKPRLRQIPSAEDLETDGGGPGQVVDDGLEHRELGHGQPEARGPAPLQQHPQVLL
  WEQQRLAGRLPRGSTGDTVLLPLAQGGHRPLSRAQSSPAAPASLSAPEPASQARVLSSSETPARTLPFTTGLIYD
  SVMLKHQCSCGDNSRHPEHAGRIQSIWSRLQERGLRSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLD
  NGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELKNGFAVVRPPGHHADHST
  AMGFCFFNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQTFYQDPSVLYISLHRHDDGNFFPGSGAVDEVGAG
  SGEGFNVNVAWAGGLDPPMGDPEYLAAFRIVVMPIAREFSPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFGYMTQ
  QLMNLAGGAVVLALEGGHDLTAICDASEACVAALLGNRVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWGCMQR
  LASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL

• Structural information:
  • Interpro: IPR000286  IPR023801  IPR037138  IPR017320  IPR023696  
  • PDB: 3C0Y 3C0Z 3C10 3ZNR 3ZNS
  • PDBsum: 3C0Y 3C0Z 3C10 3ZNR 3ZNS
  • DIP: 29860
  • STRING: ENSP00000080059
• Other Databases: GeneCards:  HDAC7  Malacards:  HDAC7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071889	14-3-3 protein binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005080	protein kinase C binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000118	histone deacetylase complex	IEA	cellular component
GO:0004407	histone deacetylase activity	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0016575	histone deacetylation	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004407	histone deacetylase activity	IEA	molecular function
GO:0032041	NAD-dependent histone deacetylase activity (H3-K14 specific)	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0001570	vasculogenesis	IEA	biological process
GO:0007043	cell-cell junction assembly	IEA	biological process
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0070491	repressing transcription factor binding	IPI	molecular function
GO:0032703	negative regulation of interleukin-2 production	IDA	biological process
GO:0090050	positive regulation of cell migration involved in sprouting angiogenesis	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070932	histone H3 deacetylation	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0033558	protein deacetylase activity	IDA	molecular function
GO:1901223	negative regulation of NIK/NF-kappaB signaling	IMP	biological process
GO:0045668	negative regulation of osteoblast differentiation	IMP	biological process
GO:0006476	protein deacetylation	IMP	biological process
GO:0033613	activating transcription factor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05034	Alcoholism
hsa05203	Viral carcinogenesis
P06959	CCKR signaling map

Diseases

Associated diseases	References
colorectal cancer	PMID:23724067
Alopecia areata	PMID:21936853
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray