• Gene id: 5153

Gene Summary

• Gene Symbol: PDE1B   Gene   UCSC   Ensembl
• Aliases: HEL-S-79p, PDE1B1, PDES1B
• Gene name: phosphodiesterase 1B
• Alternate names: calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B, 63 kDa Cam-PDE, calcium/calmodulin-stimulated cyclic nucleotide phosphodiesterase, calmodulin-stimulated phosphodiesterase PDE1B1, cam-PDE 1B, epididymis secretory sperm binding protein,
• Gene location: 12q13.2 (54549392: 54579238)     Exons: 5     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE1 subfamily. Members of the PDE1 family are calmodulin-dependent PDEs that are stimulated by a calcium-calmodulin complex. This PDE has dual-specifici
• OMIM: 171891

Protein Summary

• Protein general information: Q01064  
  • Name: Calcium/calmodulin dependent 3',5' cyclic nucleotide phosphodiesterase 1B (Cam PDE 1B) (EC 3.1.4.17) (63 kDa Cam PDE)
  • Length: 536  
  • Mass: 61380
• Sequence:

  MELSPRSPPEMLEESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEINIEELKKNLEYTASLLEAVYIDET
  RQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKPKFRSIVHAVQAGIFVERMFRRTYTSVGPTY
  STAVLNCLKNLDLWCFDVFSLNQAADDHALRTIVFELLTRHNLISRFKIPTVFLMSFLDALETGYGKYKNPYHNQ
  IHAADVTQTVHCFLLRTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKSECAIVYNDRSVLENHHISSV
  FRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTALQQLERIDKPKALSLLLHAADISHPT
  KQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQSQIGFIDFIVEPTFSVLTDVAEKSVQPLADE
  DSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPA
  EDEHNQNGNLD

• Structural information:
  • Protein Domains: (146..50-)
    (/note="PDEase-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01192"-)
  • Interpro: IPR003607  IPR023088  IPR002073  IPR036971  IPR023174   IPR013706  
  • Prosite: PS00126 PS51845
  • CDD: cd00077
  • PDB: 1LXR 1TAZ 4NPV 4NPW 5B25 5UOY 5UP0 5W6E
  • PDBsum: 1LXR 1TAZ 4NPV 4NPW 5B25 5UOY 5UP0 5W6E
  • STRING: ENSP00000243052
• Other Databases: GeneCards:  PDE1B  Malacards:  PDE1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043025	neuronal cell body	IBA	cellular component
GO:0048101	calcium- and calmodulin-regulated 3',5'-cyclic-GMP phosphodiesterase activity	IBA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004114	3',5'-cyclic-nucleotide phosphodiesterase activity	IEA	molecular function
GO:0008081	phosphoric diester hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004117	calmodulin-dependent cyclic-nucleotide phosphodiesterase activity	TAS	molecular function
GO:0006915	apoptotic process	TAS	biological process
GO:0004114	3',5'-cyclic-nucleotide phosphodiesterase activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0004112	cyclic-nucleotide phosphodiesterase activity	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0001505	regulation of neurotransmitter levels	IEA	biological process
GO:0008542	visual learning	IEA	biological process
GO:0001975	response to amphetamine	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007626	locomotory behavior	IEA	biological process
GO:0042053	regulation of dopamine metabolic process	IEA	biological process
GO:0042428	serotonin metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0097011	cellular response to granulocyte macrophage colony-stimulating factor stimulus	IDA	biological process
GO:0047555	3',5'-cyclic-GMP phosphodiesterase activity	IDA	molecular function
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	IDA	molecular function
GO:0036006	cellular response to macrophage colony-stimulating factor stimulus	IDA	biological process
GO:0030224	monocyte differentiation	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04020	Calcium signaling pathway
hsa00230	Purine metabolism
hsa04740	Olfactory transduction
hsa05032	Morphine addiction
hsa04742	Taste transduction
hsa04924	Renin secretion

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881