• Gene id: 51528

Gene Summary

• Gene Symbol: JKAMP   Gene   UCSC   Ensembl
• Aliases: C14orf100, C24orf100, CDA06, HSPC213, HSPC327, JAMP
• Gene name: JNK1/MAPK8 associated membrane protein
• Alternate names: JNK1/MAPK8-associated membrane protein, JNK-associated membrane protein, Jun N-terminal kinase 1-associated membrane protein, medulloblastoma antigen MU-MB-50.4,
• Gene location: 14q23.1 (196176502: 196133582)     Exons: 12     NC_000002.12
• OMIM: 611176

Protein Summary

• Protein general information: Q9P055  
  • Name: JNK1/MAPK8 associated membrane protein (JKAMP) (JNK1 associated membrane protein) (JAMP) (Medulloblastoma antigen MU MB 50.4)
  • Length: 319  
  • Mass: 36169
• Sequence:

  MKGEIQQSLGAWVLLTCLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKYCQPCTESPELYDWLYLGFMAML
  PLVLHWFFIEWYSGKKSSSALFQHITALFECSMAAIITLLVSDPVGVLYIRSCRVLMLSDWYTMLYNPSPDYVTT
  VHCTHEAVYPLYTIVFIYYAFCLVLMMLLRPLLVKKIACGLGKSDRFKSIYAALYFFPILTVLQAVGGGLLYYAF
  PYIILVLSLVTLAVYMSASEIENCYDLLVRKKRLIVLFSHWLLHAYGIISISRVDKLEQDLPLLALVPTPALFYL
  FTAKFTEPSRILSEGANGH

• Structural information:
  • Interpro: IPR008485  
  • STRING: ENSP00000450749
• Other Databases: GeneCards:  JKAMP  Malacards:  JKAMP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030433	ubiquitin-dependent ERAD pathway	IBA	biological process
GO:0031625	ubiquitin protein ligase binding	IBA	molecular function
GO:0030433	ubiquitin-dependent ERAD pathway	IDA	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0006986	response to unfolded protein	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006986	response to unfolded protein	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)