Male Infertility Database

Search Result

Gene id

51526

Gene Summary Protein Summary Gene ontology Diseases PubMed

Gene Summary

Gene Symbol

OSER1 Gene UCSC Ensembl

Aliases

C20orf111, HSPC207, Osr1, Perit1, dJ1183I21.1

Gene name

oxidative stress responsive serine rich 1

Alternate names

oxidative stress-responsive serine-rich protein 1, oxidative stress-responsive 1, oxidative stress-responsive protein 1, peroxide-inducible transcript 1 protein,

Gene location

20q13.12 (44217228: 44195938) Exons: 8 NC_000020.11

Protein Summary

Protein general information

Q9NX31

Name: Oxidative stress responsive serine rich protein 1 (Oxidative stress responsive protein 1) (Peroxide inducible transcript 1 protein)

Length: 292 Mass: 31779

Sequence

MKSEAKDGEEESLQTAFKKLRVDASGSVASLSVGEGTGVRAPVRTATDDTKPKTTCASKDSWHGSTRKSSRGAVR
TQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSGLGISSPKEFSAGESSTSLDANHTGAVVEPL
RTSVPRLPSESKKEDSSDATQVPQASLKASDLSDFQSVSKLNQGKPCTCIGKECQCKRWHDMEVYSFSGLQSVPP
LAPERRSTLEDYSQSLHARTLSGSPRSCSEQARVFVDDVTIEDLSGYMEYYLYIPKKMSHMAEMMYT

Structural information

Interpro:	IPR008494
STRING:	ENSP00000362061

Other Databases

GeneCards: OSER1 Malacards: OSER1

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0070301	cellular response to hydr ogen peroxide	IBA	biological process

Diseases

Expand All | Collapse All

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
17327269	Teratozoos permia	13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
17327269	Teratozoos permia	19 (6 controls , 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
21674046	Aberrant C pGs in Low Motility Sperm	18	Male infertility	GSE26881	Show abstract
31037746	Spermatoge nic defect s	28 men with az oospermia	Male infertility	Microarray	Show abstract
31037746	Spermatoge nic defect s	16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Diseases

Expand All | Collapse All