• Gene id: 51523

Gene Summary

• Gene Symbol: CXXC5   Gene   UCSC   Ensembl
• Aliases: CF5, HSPC195, RINF, WID
• Gene name: CXXC finger protein 5
• Alternate names: CXXC-type zinc finger protein 5, CXXC finger 5 protein, WT1-induced Inhibitor of Dishevelled, putative MAPK-activating protein PM08, putative NF-kappa-B-activating protein 102, retinoid-inducible nuclear factor,
• Gene location: 5q31.2 (139647298: 139683884)     Exons: 11     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is a retinoid-inducible nuclear protein containing a CXXC-type zinc finger motif. The encoded protein is involved in myelopoiesis, is required for DNA damage-induced p53 activation, regulates the differentiation of C2C12 m
• OMIM: 612752

Protein Summary

• Protein general information: Q7LFL8  
  • Name: CXXC type zinc finger protein 5 (CF5) (Putative MAPK activating protein PM08) (Putative NF kappa B activating protein 102) (Retinoid inducible nuclear factor) (RINF)
  • Length: 322  
  • Mass: 32977
• Sequence:

  MSSLGGGSQDAGGSSSSSTNGSGGSGSSGPKAGAADKSAVVAAAAPASVADDTPPPERRNKSGIISEPLNKSLRR
  SRPLSHYSSFGSSGGSGGGSMMGGESADKATAAAAAASLLANGHDLAAAMAVDKSNPTSKHKSGAVASLLSKAER
  ATELAAEGQLTLQQFAQSTEMLKRVVQEHLPLMSEAGAGLPDMEAVAGAEALNGQSDFPYLGAFPINPGLFIMTP
  AGVFLAESALHMAGLAEYPMQGELASAISSGKKKRKRCGMCAPCRRRINCEQCSSCRNRKTGHQICKFRKCEELK
  KKPSAALEKVMLPTGAAFRWFQ

• Structural information:
  • Interpro: IPR040388  IPR002857  
  • Prosite: PS51058
  • PDB: 5W9S
  • PDBsum: 5W9S
  • STRING: ENSP00000302543
• Other Databases: GeneCards:  CXXC5  Malacards:  CXXC5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0008134	transcription factor binding	IDA	molecular function
GO:0008327	methyl-CpG binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R