• Gene id: 5150

Gene Summary

• Gene Symbol: PDE7A   Gene   UCSC   Ensembl
• Aliases: HCP1, PDE7
• Gene name: phosphodiesterase 7A
• Alternate names: high affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A, TM22, phosphodiesterase isozyme 7,
• Gene location: 8q13.1 (30895823: 30903559)     Exons: 4     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE7 subfamily. This PDE hydrolyzes the second messenger, cAMP, which is a regulator and mediator of a number of cellular responses to extracellular sign
• OMIM: 171885

Protein Summary

• Protein general information: Q13946  
  • Name: High affinity cAMP specific 3',5' cyclic phosphodiesterase 7A (EC 3.1.4.53) (HCP1) (TM22)
  • Length: 482  
  • Mass: 55505
  • Tissue specificity: PDE7A1 is found at high levels in skeletal muscle and at low levels in a variety of tissues including brain and heart. It is expressed as well in two T-cell lines. PDE7A2 is found abundantly in skeletal muscle and at low levels in hear
• Sequence:

  MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPNPRQLSQRRGAISYDSSDQTALYIRMLGDVRVRSRA
  GFESERRGSHPYIDFRIFHSQSEIEVSVSARNIRRLLSFQRYLRSSRFFRGTAVSNSLNILDDDYNGQAKCMLEK
  VGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMH
  CYLKEPKLANSVTPWDILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFS
  HLPLESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDTRHRHLVLQMALKCADICNPCRTWELSKQ
  WSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYLVEPLFTEWARFSNTRLSQTMLGHVGLNKAS
  WKGLQREQSSSEDTDAAFELNSQLLPQENRLS

• Structural information:
  • Protein Domains: (136..45-)
    (/note="PDEase-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01192"-)
  • Interpro: IPR003607  IPR023088  IPR002073  IPR036971  IPR023174  
  • Prosite: PS00126 PS51845
  • CDD: cd00077
  • PDB: 1ZKL 3G3N 4PM0 4Y2B
  • PDBsum: 1ZKL 3G3N 4PM0 4Y2B
  • STRING: ENSP00000385632
• Other Databases: GeneCards:  PDE7A  Malacards:  PDE7A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	IBA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004114	3',5'-cyclic-nucleotide phosphodiesterase activity	IEA	molecular function
GO:0008081	phosphoric diester hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	IDA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0006198	cAMP catabolic process	IEA	biological process
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00230	Purine metabolism
hsa05032	Morphine addiction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)