Search Result
| Gene id | 51454 | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||
| Gene Symbol | GULP1 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||
| Aliases | CED-6, CED6, GULP | ||||||||||||||||||||||||||||||||||||
| Gene name | GULP PTB domain containing engulfment adaptor 1 | ||||||||||||||||||||||||||||||||||||
| Alternate names | PTB domain-containing engulfment adapter protein 1, GULP, engulfment adaptor PTB domain containing 1, PTB domain adapter protein CED-6, PTB domain adaptor protein CED-6, cell death protein 6 homolog, engulfment adapter protein, | ||||||||||||||||||||||||||||||||||||
| Gene location |
2q32.1-q32.2 (188291698: 188595925) Exons: 18 NC_000002.12 |
||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene is an adapter protein necessary for the engulfment of apoptotic cells by phagocytes. Several transcript variants, some protein coding and some thought not to be protein coding, have been found for this gene. [provided by R |
||||||||||||||||||||||||||||||||||||
| OMIM | 608165 | ||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||
| Protein general information | Q9UBP9 Name: PTB domain containing engulfment adapter protein 1 (Cell death protein 6 homolog) (PTB domain adapter protein CED 6) (Protein GULP) Length: 304 Mass: 34490 Tissue specificity: Widely expressed. Detected in macrophages, pancreas, kidney, skeletal muscle, heart, colon, intestine, lung, placenta and ovary. {ECO | ||||||||||||||||||||||||||||||||||||
| Sequence |
MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQIS IYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCYVFDSEKCAEEITLTIGQAFDLAYR KFLESGGKDVETRKQIAGLQKRIQDLETENMELKNKVQDLENQLRITQVSAPPAGSMTPKSPSTDIFDMIPFSPI SHQSSMPTRNGTQPPPVPSRSTEIKRDLFGAEPFDPFNCGAADFPPDIQSKLDEMQEGFKMGLTLEGTVFCLDPL DSRC | ||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: GULP1  Malacards: GULP1 | ||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||