• Gene id: 51440

Gene Summary

• Gene Symbol: HPCAL4   Gene   UCSC   Ensembl
• Aliases: HLP4
• Gene name: hippocalcin like 4
• Alternate names: hippocalcin-like protein 4,
• Gene location: 1p34.2 (39691484: 39678647)     Exons: 6     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is highly similar to human hippocalcin protein and hippocalcin like-1 protein. It also has similarity to rat neural visinin-like Ca2+-binding protein-type 1 and 2 proteins. This encoded protein may be involved in the calci

Protein Summary

• Protein general information: Q9UM19  
  • Name: Hippocalcin like protein 4 (HLP4)
  • Length: 191  
  • Mass: 22202
• Sequence:

  MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFRTFDKN
  GDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRMNQDGLTPQQR
  VDKIFKKMDQDKDDQITLEEFKEAAKSDPSIVLLLQCDMQK

• Structural information:
  • Protein Domains: (24..5-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (60..9-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (96..13-)
    (/note="EF-hand-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU0044-)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR028846  IPR029534  
  • Prosite: PS00018 PS50222
  • CDD: cd00051
  • STRING: ENSP00000361935
• Other Databases: GeneCards:  HPCAL4  Malacards:  HPCAL4

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)