• Gene id: 51406

Gene Summary

• Gene Symbol: NOL7   Gene   UCSC   Ensembl
• Aliases: C6orf90, PQBP3, RARG-1, dJ223E5.2
• Gene name: nucleolar protein 7
• Alternate names: nucleolar protein 7, nucleolar protein 7, 27kDa, nucleolar protein of 27 kDa, polyglutamine binding protein 3, retinoic acid repressible protein,
• Gene location: 6p23 (13615326: 13632469)     Exons: 9     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene localizes to the nucleolus, where it maintains nucleolar structure and cell growth rates. The encoded protein also functions as a tumor suppressor and regulator of angiogenesis. The RB tumor suppressor gene recruits transc
• OMIM: 611533

Protein Summary

• Protein general information: Q9UMY1  
  • Name: Nucleolar protein 7 (Nucleolar protein of 27 kDa)
  • Length: 257  
  • Mass: 29426
  • Tissue specificity: Expressed in numerous tissues. Particularly prevalent in the adrenal gland, thyroid gland, heart and skeletal muscle. {ECO
• Sequence:

  MVQLRPRASRAPASAEAMVDEGQLASEEEEAEHGLLLGQPSSGAAAEPLEEDEEGDDEFDDEAPEELTFASAQAE
  AREEERRVRETVRRDKTLLKEKRKRREELFIEQKKRKLLPDTILEKLTTASQTNIKKSPGKVKEVNLQKKNEDCE
  KGNDSKKVKVQKVQSVSQNKSYLAVRLKDQDLRDSRQQAAQAFIHNSLYGPGTNRTTVNKFLSLANKRLPVKRAA
  VQFLNNAWGIQKKQNAKRFKRRWMVRKMKTKK

• Structural information:
  • Interpro: IPR039626  IPR012579  
  • STRING: ENSP00000405674
• Other Databases: GeneCards:  NOL7  Malacards:  NOL7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881