• Gene id: 5140

Gene Summary

• Gene Symbol: PDE3B   Gene   UCSC   Ensembl
• Aliases: HcGIP1, cGIPDE1
• Gene name: phosphodiesterase 3B
• Alternate names: cGMP-inhibited 3',5'-cyclic phosphodiesterase B, CGI-PDE B, CGIP1, cyclic GMP-inhibited phosphodiesterase B, cyclic nucleotide phosphodiesterase, phosphodiesterase 3B, cGMP-inhibited,
• Gene location: 11p15.2 (14643690: 14874138)     Exons: 18     NC_000011.10
• OMIM: 602047

Protein Summary

• Protein general information: Q13370  
  • Name: cGMP inhibited 3',5' cyclic phosphodiesterase B (EC 3.1.4.17) (CGIPDE1) (CGIP1) (Cyclic GMP inhibited phosphodiesterase B) (CGI PDE B)
  • Length: 1112  
  • Mass: 124333
  • Tissue specificity: Abundant in adipose tissues.
• Sequence:

  MRRDERDAKAMRSLQPPDGAGSPPESLRNGYVKSCVSPLRQDPPRGFFFHLCRFCNVELRPPPASPQQPRRCSPF
  CRARLSLGALAAFVLALLLGAEPESWAAGAAWLRTLLSVCSHSLSPLFSIACAFFFLTCFLTRTKRGPGPGRSCG
  SWWLLALPACCYLGDFLVWQWWSWPWGDGDAGSAAPHTPPEAAAGRLLLVLSCVGLLLTLAHPLRLRHCVLVLLL
  ASFVWWVSFTSLGSLPSALRPLLSGLVGGAGCLLALGLDHFFQIREAPLHPRLSSAAEEKVPVIRPRRRSSCVSL
  GETAASYYGSCKIFRRPSLPCISREQMILWDWDLKQWYKPHYQNSGGGNGVDLSVLNEARNMVSDLLTDPSLPPQ
  VISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPV
  EQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVS
  TGSLTNRSPIEFPDTADFLNKPSVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSG
  KSGEEENIFSKESFKLMETQQEEETEKKDSRKLFQEGDKWLTEEAQSEQQTNIEQEVSLDLILVEEYDSLIEKMS
  NWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLLEIFKIPTQQFMNYFRALENGYRDIPYHNRIHATDVLHAVW
  YLTTRPVPGLQQIHNGCGTGNETDSDGRINHGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDH
  PGRTNAFLVATNAPQAVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFD
  FLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFYEQGDEEANLGLPISP
  FMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAEEDNDTESGDDEDGEELDTEDEEMENNLNPKPPR
  RKSRRRIFCQLMHHLTENHKIWKEIVEEEEKCKADGNKLQVENSSLPQADEIQVIEEADEEE

• Structural information:
  • Protein Domains: (651..107-)
    (/note="PDEase-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01192"-)
  • Interpro: IPR003607  IPR002073  IPR036971  IPR023174  
  • Prosite: PS00126 PS51845
  • CDD: cd00077
  • PDB: 1SO2 1SOJ
  • PDBsum: 1SO2 1SOJ
  • STRING: ENSP00000282096
• Other Databases: GeneCards:  PDE3B  Malacards:  PDE3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	IBA	molecular function
GO:0043422	protein kinase B binding	IBA	molecular function
GO:0016020	membrane	IBA	cellular component
GO:0043951	negative regulation of cAMP-mediated signaling	IBA	biological process
GO:0016525	negative regulation of angiogenesis	IMP	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0004114	3',5'-cyclic-nucleotide phosphodiesterase activity	IEA	molecular function
GO:0008081	phosphoric diester hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004119	cGMP-inhibited cyclic-nucleotide phosphodiesterase activity	TAS	molecular function
GO:0004114	3',5'-cyclic-nucleotide phosphodiesterase activity	IEA	molecular function
GO:0004114	3',5'-cyclic-nucleotide phosphodiesterase activity	EXP	molecular function
GO:0004114	3',5'-cyclic-nucleotide phosphodiesterase activity	EXP	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043422	protein kinase B binding	ISS	molecular function
GO:0004114	3',5'-cyclic-nucleotide phosphodiesterase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0033629	negative regulation of cell adhesion mediated by integrin	IC	biological process
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0005794	Golgi apparatus	ISS	cellular component
GO:0032869	cellular response to insulin stimulus	ISS	biological process
GO:0050995	negative regulation of lipid catabolic process	IMP	biological process
GO:0016020	membrane	IDA	cellular component
GO:0032045	guanyl-nucleotide exchange factor complex	IDA	cellular component
GO:0007162	negative regulation of cell adhesion	IMP	biological process
GO:0043951	negative regulation of cAMP-mediated signaling	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04024	cAMP signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa00230	Purine metabolism
hsa04371	Apelin signaling pathway
hsa04910	Insulin signaling pathway
hsa04922	Glucagon signaling pathway
hsa05032	Morphine addiction
hsa04914	Progesterone-mediated oocyte maturation
hsa04924	Renin secretion
hsa04923	Regulation of lipolysis in adipocytes

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq