Search Result
| Gene id | 51390 | ||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | AIG1 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | AIG-1, dJ95L4.1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | androgen induced 1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | androgen-induced gene 1 protein, FAHFA hydrolase AIG1, fatty acid esters of hydroxy fatty acids hydrolase AIG1, | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
6q24.2 (143059362: 143343882) Exons: 17 NC_000006.12 |
||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 608514 | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q9NVV5 Name: Androgen induced gene 1 protein (AIG 1) (Fatty acid esters of hydroxy fatty acids hydrolase AIG1) (FAHFA hydrolase AIG1) (EC 3.1. . ) Length: 245 Mass: 28222 Tissue specificity: Highly expressed in heart, ovary, testis, liver, and kidney, at lower levels in spleen, prostate, brain, skeletal muscle, pancreas, small intestine and colon, and undetected in peripheral blood leukocytes, thymus, lung and placenta. AI | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MALVPCQVLRMAILLSYCSILCNYKAIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLTRGSGNQEQ ERQLKKLISLRDWMLAVLAFPVGVFVVAVFWIIYAYDREMIYPKLLDNFIPGWLNHGMHTTVLPFILIEMRTSHH QYPSRSSGLTAICTFSVGYILWVCWVHHVTGMWVYPFLEHIGPGARIIFFGSTTILMNFLYLLGEVLNNYIWDTQ KKPPSWQDMKIKFMYLGPSS | ||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: AIG1  Malacards: AIG1 | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||