• Gene id: 51378

Gene Summary

• Gene Symbol: ANGPT4   Gene   UCSC   Ensembl
• Aliases: ANG3, ANG4
• Gene name: angiopoietin 4
• Alternate names: angiopoietin-4,
• Gene location: 20p13 (916367: 869899)     Exons: 16     NC_000020.11
• Gene summary(Entrez): Angiopoietins are proteins with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor. The mechanism by which they contribute to angiogenesis
• OMIM: 603705

Protein Summary

• Protein general information: Q9Y264  
  • Name: Angiopoietin 4 (ANG 4) (Angiopoietin 3) (ANG 3)
  • Length: 503  
  • Mass: 56849
  • Tissue specificity: Highly expressed in the lung with much lower levels found in other tissues.
• Sequence:

  MLSQLAMLQGSLLLVVATMSVAQQTRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLAN
  PLHLGKLPTQQVKQLEQALQNNTQWLKKLERAIKTILRSKLEQVQQQMAQNQTAPMLELGTSLLNQTTAQIRKLT
  DMEAQLLNQTSRMDAQMPETFLSTNKLENQLLLQRQKLQQLQGQNSALEKRLQALETKQQEELASILSKKAKLLN
  TLSRQSAALTNIERGLRGVRHNSSLLQDQQHSLRQLLVLLRHLVQERANASAPAFIMAGEQVFQDCAEIQRSGAS
  ASGVYTIQVSNATKPRKVFCDLQSSGGRWTLIQRRENGTVNFQRNWKDYKQGFGDPAGEHWLGNEVVHQLTRRAA
  YSLRVELQDWEGHEAYAQYEHFHLGSENQLYRLSVVGYSGSAGRQSSLVLQNTSFSTLDSDNDHCLCKCAQVMSG
  GWWFDACGLSNLNGVYYHAPDNKYKMDGIRWHYFKGPSYSLRASRMMIRPLDI

• Structural information:
  • Protein Domains: (282..50-)
    (/note="Fibrinogen-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00739"-)
  • Interpro: IPR028845  IPR036056  IPR014716  IPR014715  IPR002181   IPR020837  
  • Prosite: PS00514 PS51406
  • CDD: cd00087
  • STRING: ENSP00000371347
• Other Databases: GeneCards:  ANGPT4  Malacards:  ANGPT4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0062023	collagen-containing extracellular matrix	IBA	cellular component
GO:0043066	negative regulation of apoptotic process	IBA	biological process
GO:0031589	cell-substrate adhesion	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0001525	angiogenesis	IBA	biological process
GO:0030971	receptor tyrosine kinase binding	IBA	molecular function
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0030971	receptor tyrosine kinase binding	IEA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007171	activation of transmembrane receptor protein tyrosine kinase activity	IEA	biological process
GO:0007171	activation of transmembrane receptor protein tyrosine kinase activity	IEA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0030297	transmembrane receptor protein tyrosine kinase activator activity	IDA	molecular function
GO:0030297	transmembrane receptor protein tyrosine kinase activator activity	IDA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0043536	positive regulation of blood vessel endothelial cell migration	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0010595	positive regulation of endothelial cell migration	IDA	biological process
GO:0030971	receptor tyrosine kinase binding	IDA	molecular function
GO:0001935	endothelial cell proliferation	IDA	NOT|biological process
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0043537	negative regulation of blood vessel endothelial cell migration	IDA	biological process
GO:0071456	cellular response to hypoxia	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa04066	HIF-1 signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq