• Gene id: 51365

Gene Summary

• Gene Symbol: PLA1A   Gene   UCSC   Ensembl
• Aliases: PS-PLA1, PSPLA1
• Gene name: phospholipase A1 member A
• Alternate names: phospholipase A1 member A, phosphatidylserine-specific phospholipase A1alpha,
• Gene location: 3q13.33 (119597847: 119629810)     Exons: 13     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a phospholipase that hydrolyzes fatty acids at the sn-1 position of phosphatidylserine and 1-acyl-2-lysophosphatidylserine. This secreted protein hydrolyzes phosphatidylserine in liposomes. Three transcript variants enc

Protein Summary

• Protein general information: Q53H76  
  • Name: Phospholipase A1 member A (EC 3.1.1. ) (Phosphatidylserine specific phospholipase A1) (PS PLA1)
  • Length: 456  
  • Mass: 49715
  • Tissue specificity: Widely expressed. Expressed in placenta, prostate and liver. Weakly or not expressed in skin, leukocytes, platelets, colon, spleen, lung, muscle and kidney. {ECO
• Sequence:

  MPPGPWESCFWVGGLILWLSVGSSGDAPPTPQPKCADFQSANLFEGTDLKVQFLLFVPSNPSCGQLVEGSSDLQN
  SGFNATLGTKLIIHGFRVLGTKPSWIDTFIRTLLRATNANVIAVDWIYGSTGVYFSAVKNVIKLSLEISLFLNKL
  LVLGVSESSIHIIGVSLGAHVGGMVGQLFGGQLGQITGLDPAGPEYTRASVEERLDAGDALFVEAIHTDTDNLGI
  RIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLYISALENSCPLMAFPCASYKAFLAGRCLDCFNPF
  LLSCPRIGLVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHHSLVEFHLKELRNKDTNIEVTFLSSNITSSSKITIP
  KQQRYGKGIIAHATPQCQINQVKFKFQSSNRVWKKDRTTIIGKFCTALLPVNDREKMVCLPEPVNLQASVTVSCD
  LKIACV

• Structural information:
  • Interpro: IPR029058  IPR013818  IPR016272  IPR033906  IPR000734  
  • Prosite: PS00120
  • CDD: cd00707
  • STRING: ENSP00000273371
• Other Databases: GeneCards:  PLA1A  Malacards:  PLA1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016298	lipase activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0004620	phospholipase activity	IBA	molecular function
GO:0016042	lipid catabolic process	IBA	biological process
GO:0004806	triglyceride lipase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0052689	carboxylic ester hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016042	lipid catabolic process	IEA	biological process
GO:0008970	phospholipase A1 activity	TAS	molecular function
GO:0006629	lipid metabolic process	TAS	biological process
GO:0006658	phosphatidylserine metabolic process	TAS	biological process
GO:0036150	phosphatidylserine acyl-chain remodeling	TAS	biological process
GO:0052739	phosphatidylserine 1-acylhydrolase activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0002080	acrosomal membrane	IEA	cellular component
GO:0008970	phospholipase A1 activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04014	Ras signaling pathway
hsa00564	Glycerophospholipid metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq