• Gene id: 51363

Gene Summary

• Gene Symbol: CHST15   Gene   UCSC   Ensembl
• Aliases: BRAG, GALNAC4S-6ST
• Gene name: carbohydrate sulfotransferase 15
• Alternate names: carbohydrate sulfotransferase 15, B cell RAG associated protein (GALNAC4S-6ST), B-cell RAG-associated gene protein, carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15, hBRAG,
• Gene location: 10q26.13 (207645132: 207723702)     Exons: 12     NC_000001.11
• Gene summary(Entrez): Chondroitin sulfate (CS) is a glycosaminoglycan which is an important structural component of the extracellular matrix and which links to proteins to form proteoglycans. Chondroitin sulfate E (CS-E) is an isomer of chondroitin sulfate in which the C-4 and
• OMIM: 608277

Protein Summary

• Protein general information: Q7LFX5  
  • Name: Carbohydrate sulfotransferase 15 (EC 2.8.2.33) (B cell RAG associated gene protein) (hBRAG) (N acetylgalactosamine 4 sulfate 6 O sulfotransferase) (GalNAc4S 6ST)
  • Length: 561  
  • Mass: 64926
  • Tissue specificity: Expressed in B-cell-enriched tissues but not in fetal or adult thymus. Expressed in fetal and adult spleen, lymph node, tonsil, bone marrow and peripheral leukocytes. Not expressed in T-cells. In pro-B, pre-B, and mature B-cell lines,
• Sequence:

  MRHCINCCIQLLPDGAHKQQVNCQGGPHHGHQACPTCKGENKILFRVDSKQMNLLAVLEVRTEGNENWGGFLRFK
  KGKRCSLVFGLIIMTLVMASYILSGAHQELLISSPFHYGGFPSNPSLMDSENPSDTKEHHHQSSVNNISYMKDYP
  SIKLIINSITTRIEFTTRQLPDLEDLKKQELHMFSVIPNKFLPNSKSPCWYEEFSGQNTTDPYLTNSYVLYSKRF
  RSTFDALRKAFWGHLAHAHGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRL
  RDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQ
  DFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPV
  RLQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNARRPEDRNL
  GPMWPITQKILRDFYRPFNARLAQVLADEAFAWKTT

• Structural information:
  • Interpro: IPR027417  
  • STRING: ENSP00000402394
• Other Databases: GeneCards:  CHST15  Malacards:  CHST15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050659	N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase activity	IEA	molecular function
GO:0030206	chondroitin sulfate biosynthetic process	TAS	biological process
GO:0050659	N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase activity	TAS	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0050656	3'-phosphoadenosine 5'-phosphosulfate binding	IDA	molecular function
GO:0050659	N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase activity	IDA	molecular function
GO:0019319	hexose biosynthetic process	IDA	biological process
GO:0016021	integral component of membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00532	Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray