Search Result
| Gene id | 51321 | ||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | AMZ2 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | archaelysin family metallopeptidase 2 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | archaemetzincin-2, archaemetzincins-2, archeobacterial metalloproteinase-like protein 2, | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
17q24.2 (48918820: 48986381) Exons: 22 NC_000003.12 |
||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene is a zinc metalloprotease that displays some activity against angiotensin-3. The encoded protein is inhibited by the aminopeptidase inhibitor amastatin, as well as by the general inhibitors o-phenanthroline and batimastat. |
||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 615169 | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q86W34 Name: Archaemetzincin 2 (EC 3.4. . ) (Archeobacterial metalloproteinase like protein 2) Length: 360 Mass: 41263 Tissue specificity: Predominantly expressed in heart and testis. Also expressed at lower levels in kidney, liver, pancreas, lung, brain and placenta. Expressed in fetal tissues such as kidney, liver, lung and brain. Down-regulated in testis from patients | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MQIIRHSEQTLKTALISKNPVLVSQYEKLNAGEQRLMNEAFQPASDLFGPITLHSPSDWITSHPEAPQDFEQFFS DPYRKTPSPNKRSIYIQSIGSLGNTRIISEEYIKWLTGYCKAYFYGLRVKLLEPVPVSVTRCSFRVNENTHNLQI HAGDILKFLKKKKPEDAFCVVGITMIDLYPRDSWNFVFGQASLTDGVGIFSFARYGSDFYSMHYKGKVKKLKKTS SSDYSIFDNYYIPEITSVLLLRSCKTLTHEIGHIFGLRHCQWLACLMQGSNHLEEADRRPLNLCPICLHKLQCAV GFSIVERYKALVRWIDDESSDTPGATPEHSHEDNGNLPKPVEAFKEWKEWIIKCLAVLQK | ||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: AMZ2  Malacards: AMZ2 | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||