Search Result
| Gene id | 51312 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | SLC25A37 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | HT015, MFRN, MFRN1, MSC, MSCP, PRO1278, PRO1584, PRO2217 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | solute carrier family 25 member 37 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | mitoferrin-1, mitochondrial iron transporter 1, mitochondrial solute carrier protein, mitoferrin, predicted protein of HQ2217, solute carrier family 25 (mitochondrial iron transporter), member 37, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
8p21.2 (23528955: 23575462) Exons: 2 NC_000008.11 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
SLC25A37 is a solute carrier localized in the mitochondrial inner membrane. It functions as an essential iron importer for the synthesis of mitochondrial heme and iron-sulfur clusters (summary by Chen et al., 2009 [PubMed 19805291]).[supplied by OMIM, Jan |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 610387 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q9NYZ2 Name: Mitoferrin 1 (Mitochondrial iron transporter 1) (Mitochondrial solute carrier protein) (Solute carrier family 25 member 37) Length: 338 Mass: 37323 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSASVSTHMTAGAMAGILEHSVMYPVDSVKTRMQS LSPDPKAQYTSIYGALKKIMRTEGFWRPLRGVNVMIMGAGPAHAMYFACYENMKRTLNDVFHHQGNSHLANGIAG SMATLLHDAVMNPAEVVKQRLQMYNSQHRSAISCIRTVWRTEGLGAFYRSYTTQLTMNIPFQSIHFITYEFLQEQ VNPHRTYNPQSHIISGGLAGALAAAATTPLDVCKTLLNTQENVALSLANISGRLSGMANAFRTVYQLNGLAGYFK GIQARVIYQMPSTAISWSVYEFFKYFLTKRQLENRAPY | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: SLC25A37  Malacards: SLC25A37 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||